Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JG90

Protein Details
Accession A0A5M9JG90    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MHSTPKKEKHRSNSRIPRRSEPEKKSRKEKDNKDKDTDFBasic
NLS Segment(s)
PositionSequence
6-31KKEKHRSNSRIPRRSEPEKKSRKEKD
Subcellular Location(s) nucl 13.5, cyto_nucl 8.333, mito 6.5, cyto_mito 4.833, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHSTPKKEKHRSNSRIPRRSEPEKKSRKEKDNKDKDTDFESVISASSTPYPTGPPASHSSKCPLRFLLSGMIDAKGGKQNGCPLRRVQLWHTIPLCLLAIINLLLIIVMPLGLAVYKITKRVHSVVIEMMRSDMDIELYVDKGGAADTGSEILEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.84
4 0.83
5 0.81
6 0.83
7 0.82
8 0.8
9 0.8
10 0.82
11 0.84
12 0.85
13 0.86
14 0.86
15 0.86
16 0.88
17 0.89
18 0.89
19 0.89
20 0.86
21 0.78
22 0.7
23 0.64
24 0.55
25 0.45
26 0.34
27 0.27
28 0.19
29 0.16
30 0.14
31 0.09
32 0.08
33 0.08
34 0.08
35 0.08
36 0.09
37 0.1
38 0.11
39 0.14
40 0.13
41 0.15
42 0.2
43 0.26
44 0.27
45 0.27
46 0.32
47 0.36
48 0.37
49 0.36
50 0.32
51 0.29
52 0.28
53 0.28
54 0.28
55 0.21
56 0.21
57 0.19
58 0.18
59 0.15
60 0.14
61 0.13
62 0.11
63 0.11
64 0.1
65 0.1
66 0.17
67 0.23
68 0.25
69 0.26
70 0.24
71 0.28
72 0.3
73 0.33
74 0.28
75 0.32
76 0.32
77 0.36
78 0.35
79 0.3
80 0.28
81 0.26
82 0.23
83 0.13
84 0.11
85 0.05
86 0.05
87 0.05
88 0.05
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.03
102 0.06
103 0.07
104 0.12
105 0.14
106 0.16
107 0.2
108 0.23
109 0.28
110 0.26
111 0.27
112 0.29
113 0.31
114 0.3
115 0.26
116 0.24
117 0.19
118 0.17
119 0.16
120 0.1
121 0.07
122 0.07
123 0.08
124 0.08
125 0.09
126 0.09
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07