Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9KA00

Protein Details
Accession A0A5M9KA00    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-71LHVWRGEKKETSRKRKRRSKILSISISIHydrophilic
NLS Segment(s)
PositionSequence
50-63EKKETSRKRKRRSK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, cyto_mito 5.333, cyto 5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSIGLIIWINSFYENCRLLLHVMSDRPPSYLARNCNDVWYGICLHVWRGEKKETSRKRKRRSKILSISISIHNVGKPNSTSDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.18
6 0.19
7 0.19
8 0.17
9 0.18
10 0.2
11 0.22
12 0.21
13 0.21
14 0.21
15 0.19
16 0.22
17 0.26
18 0.28
19 0.28
20 0.31
21 0.31
22 0.31
23 0.3
24 0.24
25 0.19
26 0.16
27 0.14
28 0.1
29 0.1
30 0.09
31 0.09
32 0.13
33 0.16
34 0.16
35 0.19
36 0.23
37 0.27
38 0.33
39 0.43
40 0.49
41 0.57
42 0.66
43 0.73
44 0.8
45 0.86
46 0.9
47 0.91
48 0.9
49 0.9
50 0.89
51 0.88
52 0.83
53 0.76
54 0.7
55 0.61
56 0.53
57 0.44
58 0.35
59 0.26
60 0.24
61 0.22
62 0.23
63 0.21