Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JV46

Protein Details
Accession A0A5M9JV46   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
49-72LNAEDRPKPSHRRKKYTGNPLLFEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 4, mito 11, nucl 10
Family & Domain DBs
Amino Acid Sequences MNIECNKKGPTILALVTLVHGIRLDQKPHAGLNVLEAKEEEAFKNFGTLNAEDRPKPSHRRKKYTGNPLLFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.15
5 0.12
6 0.08
7 0.08
8 0.06
9 0.13
10 0.16
11 0.17
12 0.17
13 0.19
14 0.2
15 0.21
16 0.21
17 0.15
18 0.12
19 0.14
20 0.19
21 0.17
22 0.16
23 0.15
24 0.15
25 0.15
26 0.16
27 0.12
28 0.08
29 0.09
30 0.09
31 0.11
32 0.1
33 0.11
34 0.14
35 0.14
36 0.16
37 0.2
38 0.23
39 0.22
40 0.24
41 0.28
42 0.31
43 0.4
44 0.48
45 0.54
46 0.62
47 0.72
48 0.78
49 0.84
50 0.88
51 0.89
52 0.88