Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JC94

Protein Details
Accession A0A5M9JC94    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MQPSGPKPTKPFKASRRRRREERERRDSEDQGBasic
NLS Segment(s)
PositionSequence
6-26PKPTKPFKASRRRRREERERR
180-195LPRRAHRRGKGKGRHP
229-230PR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MQPSGPKPTKPFKASRRRRREERERRDSEDQGQNPDQSRGHLRDRGEYGQGEGQRRQEDPYNDPEIEEAGYDSEPDYTSRQKERNMRDRDWGWDSRERDGDLRDIPRHSGAGTEAGYGYGYGYGYPYEESHGSHSRPNSPTASSHRASVRNISRKHRAAPEPPPRQPTSASLLCGPHGALPRRAHRRGKGKGRHPPTTIHATTQFLRRHPRGAQLATGSTERRLAPREPRRGARSDHGSSAGGGMRDRADRYGLKDEVRGLFTDSPRGLAGGALGALVGGWATEKLQEAQTGRDRRAMGDRAKVYTLLGAAAGGWSRTRCVDKWQGGGRRRGRGGAEEKYPDGTEDARVREGGEEEGSRARARSQPGPKYVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.89
4 0.9
5 0.93
6 0.94
7 0.94
8 0.95
9 0.95
10 0.94
11 0.9
12 0.88
13 0.85
14 0.79
15 0.76
16 0.75
17 0.67
18 0.64
19 0.6
20 0.56
21 0.51
22 0.51
23 0.42
24 0.36
25 0.41
26 0.38
27 0.42
28 0.42
29 0.42
30 0.45
31 0.49
32 0.49
33 0.45
34 0.4
35 0.36
36 0.37
37 0.4
38 0.37
39 0.35
40 0.37
41 0.36
42 0.36
43 0.36
44 0.38
45 0.38
46 0.37
47 0.41
48 0.42
49 0.39
50 0.38
51 0.35
52 0.28
53 0.24
54 0.19
55 0.13
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.1
63 0.13
64 0.17
65 0.23
66 0.3
67 0.34
68 0.41
69 0.49
70 0.58
71 0.65
72 0.68
73 0.65
74 0.67
75 0.64
76 0.63
77 0.6
78 0.54
79 0.5
80 0.49
81 0.48
82 0.44
83 0.45
84 0.4
85 0.36
86 0.33
87 0.31
88 0.29
89 0.32
90 0.31
91 0.29
92 0.29
93 0.28
94 0.27
95 0.23
96 0.19
97 0.14
98 0.14
99 0.13
100 0.12
101 0.11
102 0.11
103 0.11
104 0.09
105 0.08
106 0.06
107 0.05
108 0.04
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.08
115 0.09
116 0.1
117 0.15
118 0.19
119 0.2
120 0.22
121 0.25
122 0.3
123 0.31
124 0.33
125 0.3
126 0.27
127 0.31
128 0.35
129 0.39
130 0.32
131 0.34
132 0.35
133 0.37
134 0.36
135 0.4
136 0.41
137 0.44
138 0.48
139 0.51
140 0.55
141 0.54
142 0.58
143 0.57
144 0.54
145 0.52
146 0.58
147 0.62
148 0.62
149 0.63
150 0.64
151 0.58
152 0.54
153 0.48
154 0.41
155 0.37
156 0.31
157 0.27
158 0.24
159 0.23
160 0.21
161 0.2
162 0.17
163 0.13
164 0.16
165 0.17
166 0.21
167 0.25
168 0.32
169 0.4
170 0.47
171 0.49
172 0.51
173 0.59
174 0.62
175 0.69
176 0.7
177 0.7
178 0.73
179 0.75
180 0.74
181 0.66
182 0.61
183 0.54
184 0.54
185 0.45
186 0.38
187 0.33
188 0.29
189 0.29
190 0.33
191 0.32
192 0.27
193 0.34
194 0.33
195 0.35
196 0.34
197 0.4
198 0.38
199 0.36
200 0.35
201 0.29
202 0.29
203 0.26
204 0.26
205 0.2
206 0.15
207 0.16
208 0.14
209 0.15
210 0.17
211 0.2
212 0.29
213 0.38
214 0.47
215 0.49
216 0.55
217 0.58
218 0.58
219 0.58
220 0.55
221 0.53
222 0.46
223 0.43
224 0.39
225 0.34
226 0.3
227 0.28
228 0.22
229 0.15
230 0.12
231 0.11
232 0.11
233 0.12
234 0.13
235 0.12
236 0.14
237 0.15
238 0.2
239 0.26
240 0.26
241 0.26
242 0.27
243 0.29
244 0.28
245 0.28
246 0.23
247 0.2
248 0.22
249 0.22
250 0.26
251 0.23
252 0.21
253 0.2
254 0.2
255 0.16
256 0.11
257 0.11
258 0.06
259 0.06
260 0.04
261 0.04
262 0.03
263 0.03
264 0.03
265 0.02
266 0.02
267 0.02
268 0.02
269 0.03
270 0.04
271 0.06
272 0.08
273 0.09
274 0.13
275 0.14
276 0.2
277 0.29
278 0.33
279 0.33
280 0.37
281 0.36
282 0.35
283 0.42
284 0.43
285 0.39
286 0.43
287 0.45
288 0.42
289 0.43
290 0.4
291 0.33
292 0.27
293 0.22
294 0.14
295 0.11
296 0.08
297 0.07
298 0.07
299 0.07
300 0.06
301 0.07
302 0.07
303 0.09
304 0.13
305 0.17
306 0.17
307 0.26
308 0.35
309 0.39
310 0.47
311 0.55
312 0.6
313 0.63
314 0.72
315 0.71
316 0.7
317 0.66
318 0.63
319 0.56
320 0.56
321 0.56
322 0.53
323 0.52
324 0.48
325 0.47
326 0.45
327 0.43
328 0.35
329 0.3
330 0.25
331 0.24
332 0.26
333 0.28
334 0.26
335 0.26
336 0.26
337 0.26
338 0.26
339 0.22
340 0.2
341 0.18
342 0.18
343 0.22
344 0.23
345 0.22
346 0.22
347 0.23
348 0.25
349 0.3
350 0.37
351 0.44
352 0.51