Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K3Q1

Protein Details
Accession A0A5M9K3Q1   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-45TSVYICTRLKRWQKNHKKIRSHRFCREFSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, mito 2, nucl 21.5
Family & Domain DBs
Amino Acid Sequences MCVEQEVRCTGCNESSTSVYICTRLKRWQKNHKKIRSHRFCREFSISRPRRQSSLGHIDCPIRPEEEQIEYQHEEEFVYDYAFQCPSPIQTYPTPYPYSFYPSWCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.23
5 0.23
6 0.19
7 0.21
8 0.22
9 0.22
10 0.24
11 0.32
12 0.42
13 0.49
14 0.59
15 0.67
16 0.75
17 0.82
18 0.9
19 0.9
20 0.91
21 0.91
22 0.92
23 0.92
24 0.89
25 0.89
26 0.85
27 0.77
28 0.73
29 0.7
30 0.62
31 0.57
32 0.59
33 0.54
34 0.53
35 0.58
36 0.53
37 0.47
38 0.46
39 0.43
40 0.39
41 0.44
42 0.39
43 0.33
44 0.34
45 0.33
46 0.32
47 0.31
48 0.24
49 0.15
50 0.14
51 0.14
52 0.15
53 0.16
54 0.18
55 0.18
56 0.21
57 0.21
58 0.21
59 0.19
60 0.17
61 0.14
62 0.12
63 0.13
64 0.08
65 0.08
66 0.08
67 0.09
68 0.11
69 0.11
70 0.11
71 0.1
72 0.1
73 0.12
74 0.16
75 0.16
76 0.19
77 0.22
78 0.3
79 0.34
80 0.38
81 0.39
82 0.36
83 0.37
84 0.35
85 0.39
86 0.33