Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JS15

Protein Details
Accession A0A5M9JS15    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
4-32HLPSNHKYTGKARKRSRERSKARSITDQEHydrophilic
NLS Segment(s)
PositionSequence
13-25GKARKRSRERSKA
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MRYHLPSNHKYTGKARKRSRERSKARSITDQEINKSTTITTTTTTTTITTTTTTTTTTIYPFSHRLRVLHQKEHIPLVNSTPRRKEGFEPSHPSIHAPLDAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.74
4 0.82
5 0.89
6 0.91
7 0.9
8 0.9
9 0.9
10 0.91
11 0.88
12 0.82
13 0.8
14 0.74
15 0.69
16 0.67
17 0.6
18 0.52
19 0.47
20 0.43
21 0.34
22 0.29
23 0.23
24 0.16
25 0.14
26 0.13
27 0.11
28 0.11
29 0.12
30 0.12
31 0.13
32 0.12
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.11
46 0.11
47 0.13
48 0.17
49 0.19
50 0.24
51 0.24
52 0.25
53 0.3
54 0.4
55 0.43
56 0.45
57 0.46
58 0.46
59 0.47
60 0.5
61 0.46
62 0.38
63 0.33
64 0.32
65 0.37
66 0.38
67 0.41
68 0.42
69 0.44
70 0.45
71 0.47
72 0.47
73 0.49
74 0.53
75 0.57
76 0.6
77 0.6
78 0.61
79 0.58
80 0.54
81 0.46
82 0.39