Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K062

Protein Details
Accession A0A5M9K062    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-45IDIKRVAVNKSKERRRRRRRRRRKEDGTNSTQTKBasic
NLS Segment(s)
PositionSequence
20-36NKSKERRRRRRRRRRKE
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
Amino Acid Sequences MVYIKQYNFRQIDIKRVAVNKSKERRRRRRRRRRKEDGTNSTQTKPNKLQISSRKERDRRGFFIGSSAFNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.42
4 0.45
5 0.44
6 0.5
7 0.5
8 0.56
9 0.63
10 0.68
11 0.76
12 0.83
13 0.86
14 0.9
15 0.92
16 0.94
17 0.95
18 0.97
19 0.97
20 0.97
21 0.96
22 0.96
23 0.95
24 0.92
25 0.88
26 0.83
27 0.75
28 0.67
29 0.61
30 0.51
31 0.47
32 0.42
33 0.42
34 0.41
35 0.39
36 0.46
37 0.5
38 0.59
39 0.62
40 0.66
41 0.7
42 0.7
43 0.78
44 0.79
45 0.78
46 0.73
47 0.72
48 0.66
49 0.55
50 0.57
51 0.49