Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JE06

Protein Details
Accession A0A5M9JE06    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-67IPGRQECKKREDKRGDKREERGERREBasic
NLS Segment(s)
PositionSequence
49-72KKREDKRGDKREERGERREEKRIR
Subcellular Location(s) mito 9.5, cyto_mito 5.5, E.R. 5, golg 5, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYSRFKQDSRFKNQERIMISFILLYGGVFFVGYWRGRKLVSIPGRQECKKREDKRGDKREERGERREEKRIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.57
4 0.49
5 0.39
6 0.35
7 0.25
8 0.21
9 0.16
10 0.11
11 0.07
12 0.05
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.06
19 0.07
20 0.08
21 0.09
22 0.1
23 0.1
24 0.11
25 0.13
26 0.2
27 0.26
28 0.31
29 0.35
30 0.4
31 0.47
32 0.5
33 0.54
34 0.49
35 0.51
36 0.55
37 0.58
38 0.62
39 0.67
40 0.75
41 0.8
42 0.86
43 0.88
44 0.85
45 0.86
46 0.86
47 0.85
48 0.82
49 0.79
50 0.78
51 0.78
52 0.76