Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JP31

Protein Details
Accession A0A5M9JP31    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
204-229HQEIDYRPGRPKTKRRKDSLSMAWGNHydrophilic
NLS Segment(s)
PositionSequence
212-220GRPKTKRRK
Subcellular Location(s) nucl 11.5, mito_nucl 11.499, mito 10, cyto_nucl 9.166, cyto_mito 7.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR005570  RPABC3  
Gene Ontology GO:0005634  C:nucleus  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03870  RNA_pol_Rpb8  
Amino Acid Sequences MTKGIITDLYKTSNIKRDVQLHSLSILRGLCNKTNTRISIFSIPTFTTNSTTRPPDRMSADAQLFDEHFTVNELDHKKYVRVGRIKATSTVDHSVSMLLDINTELYPLAVGDNIRVVLATSLQLDGTKDDTKGWRDANRVGLGGEATLADMFDYVCHGKIYRFEDQENSDLIKAYISFGGLLMGLEGPYKKAHTFKSRPCLPSHQEIDYRPGRPKTKRRKDSLSMAWGNLSRNPADENRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.45
4 0.5
5 0.53
6 0.56
7 0.53
8 0.45
9 0.43
10 0.39
11 0.33
12 0.28
13 0.23
14 0.18
15 0.21
16 0.24
17 0.27
18 0.31
19 0.35
20 0.37
21 0.43
22 0.44
23 0.43
24 0.41
25 0.41
26 0.42
27 0.41
28 0.36
29 0.32
30 0.3
31 0.28
32 0.27
33 0.24
34 0.21
35 0.2
36 0.22
37 0.24
38 0.3
39 0.31
40 0.34
41 0.35
42 0.36
43 0.38
44 0.38
45 0.36
46 0.36
47 0.35
48 0.31
49 0.29
50 0.25
51 0.21
52 0.19
53 0.16
54 0.1
55 0.08
56 0.09
57 0.08
58 0.08
59 0.14
60 0.15
61 0.17
62 0.19
63 0.2
64 0.2
65 0.25
66 0.29
67 0.31
68 0.35
69 0.37
70 0.42
71 0.46
72 0.46
73 0.44
74 0.43
75 0.36
76 0.33
77 0.32
78 0.25
79 0.21
80 0.19
81 0.16
82 0.13
83 0.12
84 0.09
85 0.06
86 0.06
87 0.05
88 0.06
89 0.06
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.09
114 0.09
115 0.09
116 0.1
117 0.13
118 0.15
119 0.19
120 0.21
121 0.22
122 0.23
123 0.26
124 0.29
125 0.28
126 0.26
127 0.22
128 0.2
129 0.16
130 0.13
131 0.1
132 0.05
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.05
141 0.05
142 0.06
143 0.07
144 0.07
145 0.08
146 0.14
147 0.19
148 0.24
149 0.26
150 0.27
151 0.3
152 0.33
153 0.34
154 0.3
155 0.26
156 0.2
157 0.18
158 0.17
159 0.13
160 0.11
161 0.1
162 0.09
163 0.07
164 0.07
165 0.06
166 0.07
167 0.06
168 0.06
169 0.05
170 0.05
171 0.04
172 0.05
173 0.06
174 0.07
175 0.08
176 0.1
177 0.12
178 0.17
179 0.24
180 0.34
181 0.43
182 0.51
183 0.6
184 0.67
185 0.67
186 0.68
187 0.7
188 0.64
189 0.65
190 0.6
191 0.55
192 0.52
193 0.51
194 0.53
195 0.5
196 0.49
197 0.46
198 0.5
199 0.53
200 0.58
201 0.67
202 0.71
203 0.76
204 0.83
205 0.85
206 0.86
207 0.86
208 0.86
209 0.85
210 0.83
211 0.76
212 0.67
213 0.62
214 0.55
215 0.49
216 0.42
217 0.36
218 0.26
219 0.23
220 0.27