Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9JZW9

Protein Details
Accession A0A5M9JZW9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-63DSSMIYRRPKRSKKAGLERNDMIHydrophilic
NLS Segment(s)
PositionSequence
48-54RPKRSKK
Subcellular Location(s) mito 7.5, mito_nucl 5.5, E.R. 5, plas 4, golg 4, nucl 2.5, extr 2
Family & Domain DBs
Amino Acid Sequences MKFSFQMMKSKTLFLFSFLFFSFFFLSFSFREVNERMEGGDSSMIYRRPKRSKKAGLERNDMIREFLEKSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.22
4 0.23
5 0.19
6 0.2
7 0.16
8 0.18
9 0.16
10 0.13
11 0.13
12 0.11
13 0.13
14 0.12
15 0.14
16 0.13
17 0.11
18 0.14
19 0.14
20 0.16
21 0.15
22 0.14
23 0.13
24 0.13
25 0.12
26 0.1
27 0.09
28 0.07
29 0.07
30 0.1
31 0.13
32 0.16
33 0.22
34 0.31
35 0.41
36 0.49
37 0.57
38 0.66
39 0.73
40 0.8
41 0.85
42 0.86
43 0.83
44 0.83
45 0.78
46 0.75
47 0.68
48 0.58
49 0.48
50 0.4
51 0.34