Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JZ12

Protein Details
Accession A0A5M9JZ12    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-39FAKLCTFEKEKKEKKEKHKTTPIPLLFHydrophilic
NLS Segment(s)
PositionSequence
23-29KKEKKEK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKEPFLLYFLLYFAKLCTFEKEKKEKKEKHKTTPIPLLFIIHYQTNSKKLNNENLPLSQPFFNHSSKPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.18
5 0.22
6 0.29
7 0.38
8 0.48
9 0.54
10 0.63
11 0.72
12 0.75
13 0.81
14 0.86
15 0.86
16 0.85
17 0.88
18 0.83
19 0.8
20 0.81
21 0.7
22 0.61
23 0.52
24 0.43
25 0.32
26 0.27
27 0.21
28 0.12
29 0.13
30 0.13
31 0.15
32 0.2
33 0.23
34 0.24
35 0.28
36 0.32
37 0.41
38 0.44
39 0.46
40 0.43
41 0.43
42 0.45
43 0.41
44 0.39
45 0.31
46 0.25
47 0.25
48 0.25
49 0.25
50 0.28