Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JWP4

Protein Details
Accession A0A5M9JWP4   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-29FNPPRPSSKSGPSKPRGRPKASTSHydrophilic
35-54DKAPAPKKARVTKPPTPQDEHydrophilic
NLS Segment(s)
PositionSequence
8-45PPRPSSKSGPSKPRGRPKASTSTSTVKDKAPAPKKARV
Subcellular Location(s) cyto_nucl 12.5, nucl 23.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPKPFNPPRPSSKSGPSKPRGRPKASTSTSTVKDKAPAPKKARVTKPPTPQDEDEQSDDPFASQPMAKSKPTPKAPTSKPSTSNNNGGPGSSSDSEIEVLSSPPAQDTTPRIQEEEEEEDEEIDERTKIPDVLLSKIMHELFTEPNSRISKEANKAVGKYMDTFVREAVARVRYAEGGRGRGVGGAFWEVEDLEKMAPQLLLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.77
4 0.76
5 0.77
6 0.81
7 0.86
8 0.86
9 0.82
10 0.8
11 0.77
12 0.79
13 0.74
14 0.69
15 0.64
16 0.62
17 0.59
18 0.57
19 0.52
20 0.43
21 0.42
22 0.43
23 0.48
24 0.48
25 0.53
26 0.54
27 0.6
28 0.67
29 0.72
30 0.76
31 0.76
32 0.76
33 0.75
34 0.79
35 0.8
36 0.77
37 0.74
38 0.68
39 0.64
40 0.61
41 0.56
42 0.5
43 0.42
44 0.36
45 0.3
46 0.27
47 0.21
48 0.15
49 0.12
50 0.09
51 0.08
52 0.09
53 0.16
54 0.19
55 0.2
56 0.25
57 0.31
58 0.39
59 0.45
60 0.49
61 0.47
62 0.53
63 0.57
64 0.6
65 0.61
66 0.58
67 0.56
68 0.55
69 0.59
70 0.54
71 0.55
72 0.48
73 0.45
74 0.4
75 0.34
76 0.3
77 0.23
78 0.22
79 0.17
80 0.16
81 0.11
82 0.12
83 0.12
84 0.11
85 0.1
86 0.07
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.06
93 0.05
94 0.07
95 0.11
96 0.15
97 0.2
98 0.21
99 0.21
100 0.2
101 0.21
102 0.23
103 0.24
104 0.2
105 0.16
106 0.15
107 0.15
108 0.15
109 0.14
110 0.11
111 0.07
112 0.06
113 0.05
114 0.06
115 0.07
116 0.07
117 0.07
118 0.1
119 0.11
120 0.14
121 0.17
122 0.17
123 0.17
124 0.2
125 0.2
126 0.17
127 0.15
128 0.15
129 0.13
130 0.15
131 0.17
132 0.15
133 0.21
134 0.23
135 0.23
136 0.23
137 0.25
138 0.3
139 0.33
140 0.39
141 0.39
142 0.4
143 0.4
144 0.43
145 0.41
146 0.35
147 0.31
148 0.28
149 0.24
150 0.23
151 0.23
152 0.19
153 0.19
154 0.17
155 0.16
156 0.19
157 0.18
158 0.17
159 0.18
160 0.19
161 0.19
162 0.2
163 0.26
164 0.24
165 0.25
166 0.25
167 0.24
168 0.23
169 0.22
170 0.22
171 0.15
172 0.13
173 0.12
174 0.11
175 0.1
176 0.11
177 0.09
178 0.1
179 0.1
180 0.09
181 0.08
182 0.09
183 0.09
184 0.1
185 0.1