Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VB84

Protein Details
Accession H1VB84   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
97-120GEKDPTGGKKEKKDKTKNKKRTSGBasic
NLS Segment(s)
PositionSequence
103-120GGKKEKKDKTKNKKRTSG
Subcellular Location(s) cyto 13, cyto_nucl 12, nucl 9, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG chig:CH63R_11921  -  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MATATAASQEFNAFYLQRTTQEFAEDLDKVREADDFKADSVPFLVHALQQGTALYSGRDQERVARPAAVTPASATAVAAEDEDVEMTETVTGRIEEGEKDPTGGKKEKKDKTKNKKRTSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.15
3 0.15
4 0.18
5 0.21
6 0.23
7 0.22
8 0.23
9 0.22
10 0.2
11 0.22
12 0.2
13 0.17
14 0.16
15 0.16
16 0.14
17 0.14
18 0.15
19 0.13
20 0.14
21 0.16
22 0.16
23 0.15
24 0.18
25 0.18
26 0.15
27 0.14
28 0.13
29 0.1
30 0.1
31 0.09
32 0.07
33 0.08
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.08
47 0.14
48 0.19
49 0.21
50 0.21
51 0.2
52 0.19
53 0.2
54 0.21
55 0.16
56 0.11
57 0.09
58 0.1
59 0.09
60 0.09
61 0.08
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.08
82 0.09
83 0.11
84 0.15
85 0.14
86 0.16
87 0.18
88 0.2
89 0.26
90 0.32
91 0.36
92 0.43
93 0.53
94 0.61
95 0.7
96 0.78
97 0.83
98 0.87
99 0.91
100 0.92