Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9J874

Protein Details
Accession A0A5M9J874   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-39LSVPKITRIRKRTYFKATNTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20.5, cyto_nucl 12, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003010  C-N_Hydrolase  
IPR036526  C-N_Hydrolase_sf  
Gene Ontology GO:0006807  P:nitrogen compound metabolic process  
Pfam View protein in Pfam  
PF00795  CN_hydrolase  
PROSITE View protein in PROSITE  
PS50263  CN_HYDROLASE  
CDD cd07197  nitrilase  
Amino Acid Sequences MPLIPRHFPLDVGAQLDTELSVPKITRIRKRTYFKATNTGEMAPLYKIALVQLCPKPLAIDYNFEKAVAFIRDAASQGCDLAVLPEYHLTSWVPDEPEFLSLCHHDITTKYLSSYQSLAIELNISIVPGTICTVHPETSLLHNTAHFISPEGKILSSYTKKNLWHPERPHLTSSTHDPHTAFETPIGKAGMLICWDTAFPEAFRELISQGAKLIIVPTFWTLSDCTPAGLARNPLSEELFVQSTLVSRAFENTCGIVFCNAGAPAGKGKKDSGFLGISQVTVPFKGALGKMGREEGMAVVELDMQILEEAEEAYKVRMDIGGDDWHYAHTLKRGNSSEESKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.16
5 0.1
6 0.1
7 0.08
8 0.1
9 0.1
10 0.15
11 0.22
12 0.3
13 0.39
14 0.46
15 0.55
16 0.63
17 0.71
18 0.76
19 0.79
20 0.81
21 0.76
22 0.79
23 0.73
24 0.68
25 0.63
26 0.54
27 0.44
28 0.36
29 0.31
30 0.22
31 0.19
32 0.14
33 0.11
34 0.1
35 0.1
36 0.12
37 0.12
38 0.2
39 0.23
40 0.25
41 0.24
42 0.24
43 0.24
44 0.22
45 0.28
46 0.21
47 0.25
48 0.26
49 0.31
50 0.31
51 0.3
52 0.28
53 0.22
54 0.24
55 0.19
56 0.16
57 0.12
58 0.14
59 0.14
60 0.15
61 0.16
62 0.13
63 0.11
64 0.11
65 0.09
66 0.07
67 0.07
68 0.07
69 0.08
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.11
76 0.1
77 0.09
78 0.11
79 0.13
80 0.13
81 0.13
82 0.15
83 0.14
84 0.16
85 0.16
86 0.14
87 0.13
88 0.12
89 0.13
90 0.12
91 0.11
92 0.1
93 0.1
94 0.15
95 0.16
96 0.16
97 0.15
98 0.18
99 0.19
100 0.2
101 0.2
102 0.17
103 0.15
104 0.15
105 0.14
106 0.11
107 0.11
108 0.09
109 0.08
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.05
118 0.05
119 0.09
120 0.11
121 0.11
122 0.11
123 0.12
124 0.13
125 0.15
126 0.18
127 0.15
128 0.14
129 0.14
130 0.15
131 0.15
132 0.15
133 0.11
134 0.1
135 0.11
136 0.11
137 0.13
138 0.12
139 0.11
140 0.11
141 0.12
142 0.16
143 0.18
144 0.19
145 0.2
146 0.24
147 0.25
148 0.31
149 0.41
150 0.42
151 0.47
152 0.49
153 0.56
154 0.58
155 0.59
156 0.54
157 0.46
158 0.41
159 0.33
160 0.35
161 0.31
162 0.26
163 0.24
164 0.23
165 0.21
166 0.24
167 0.24
168 0.18
169 0.15
170 0.16
171 0.15
172 0.17
173 0.16
174 0.12
175 0.11
176 0.11
177 0.09
178 0.08
179 0.08
180 0.06
181 0.06
182 0.06
183 0.06
184 0.07
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.08
191 0.08
192 0.07
193 0.11
194 0.11
195 0.1
196 0.1
197 0.1
198 0.09
199 0.08
200 0.09
201 0.05
202 0.05
203 0.06
204 0.07
205 0.07
206 0.07
207 0.08
208 0.09
209 0.09
210 0.12
211 0.11
212 0.1
213 0.1
214 0.1
215 0.11
216 0.13
217 0.15
218 0.13
219 0.15
220 0.16
221 0.16
222 0.17
223 0.15
224 0.14
225 0.13
226 0.13
227 0.11
228 0.1
229 0.09
230 0.09
231 0.1
232 0.1
233 0.08
234 0.08
235 0.12
236 0.13
237 0.14
238 0.14
239 0.13
240 0.13
241 0.13
242 0.14
243 0.1
244 0.09
245 0.08
246 0.09
247 0.08
248 0.09
249 0.08
250 0.09
251 0.15
252 0.19
253 0.2
254 0.2
255 0.22
256 0.25
257 0.27
258 0.27
259 0.25
260 0.22
261 0.22
262 0.24
263 0.23
264 0.2
265 0.17
266 0.18
267 0.14
268 0.13
269 0.13
270 0.09
271 0.09
272 0.13
273 0.13
274 0.17
275 0.19
276 0.21
277 0.21
278 0.23
279 0.23
280 0.19
281 0.2
282 0.15
283 0.13
284 0.11
285 0.09
286 0.08
287 0.08
288 0.08
289 0.07
290 0.06
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.05
297 0.05
298 0.06
299 0.06
300 0.07
301 0.09
302 0.09
303 0.09
304 0.1
305 0.11
306 0.12
307 0.15
308 0.2
309 0.19
310 0.21
311 0.21
312 0.2
313 0.2
314 0.19
315 0.18
316 0.2
317 0.25
318 0.27
319 0.35
320 0.39
321 0.43
322 0.49