Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JIP9

Protein Details
Accession A0A5M9JIP9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LTMPSSPRKKRDQHHPTDGGRRLBasic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.5, nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019439  FMP27/BLTP2_N  
Pfam View protein in Pfam  
PF10344  Fmp27  
Amino Acid Sequences MFLTMPSSPRKKRDQHHPTDGGRRLAIHVRGFESFVVEATEKWEIEPFISIPRFEVALSTSSDNQGPIFHLNSHVKSVLVQYSLYRHYACGVASTVLRRAFVRTYADVAEAEEAARATSYQSDASTLLSPVTSPGGFAWPGWTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.82
4 0.84
5 0.81
6 0.82
7 0.79
8 0.71
9 0.61
10 0.51
11 0.44
12 0.42
13 0.4
14 0.33
15 0.3
16 0.29
17 0.28
18 0.29
19 0.25
20 0.21
21 0.16
22 0.13
23 0.13
24 0.11
25 0.1
26 0.11
27 0.13
28 0.11
29 0.11
30 0.13
31 0.11
32 0.11
33 0.12
34 0.1
35 0.14
36 0.15
37 0.15
38 0.14
39 0.14
40 0.14
41 0.13
42 0.13
43 0.08
44 0.09
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.13
58 0.15
59 0.16
60 0.17
61 0.16
62 0.14
63 0.13
64 0.15
65 0.12
66 0.1
67 0.1
68 0.09
69 0.11
70 0.13
71 0.14
72 0.13
73 0.11
74 0.12
75 0.13
76 0.12
77 0.11
78 0.1
79 0.1
80 0.1
81 0.11
82 0.14
83 0.14
84 0.15
85 0.14
86 0.16
87 0.16
88 0.18
89 0.21
90 0.19
91 0.21
92 0.2
93 0.21
94 0.18
95 0.18
96 0.16
97 0.11
98 0.1
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.09
107 0.09
108 0.1
109 0.11
110 0.12
111 0.14
112 0.14
113 0.13
114 0.12
115 0.11
116 0.1
117 0.1
118 0.13
119 0.1
120 0.1
121 0.1
122 0.13
123 0.14
124 0.14