Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V4Y1

Protein Details
Accession H1V4Y1   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
10-38DRLDRPSAYYHNKNKRRRPDHRDARDAEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MQVRHRNTVDRLDRPSAYYHNKNKRRRPDHRDARDAEDEAASKNEPLPEDPLANATTLYVGNLSFYTTEEQVRHVREAMPERKILRRPKDSTTNQLDHGGGHGGGRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.45
4 0.46
5 0.49
6 0.53
7 0.59
8 0.68
9 0.76
10 0.82
11 0.85
12 0.87
13 0.88
14 0.88
15 0.88
16 0.9
17 0.89
18 0.88
19 0.8
20 0.77
21 0.7
22 0.61
23 0.5
24 0.4
25 0.31
26 0.23
27 0.2
28 0.14
29 0.1
30 0.1
31 0.11
32 0.1
33 0.11
34 0.13
35 0.13
36 0.13
37 0.13
38 0.13
39 0.12
40 0.12
41 0.1
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.08
54 0.08
55 0.11
56 0.1
57 0.14
58 0.17
59 0.2
60 0.2
61 0.19
62 0.2
63 0.23
64 0.32
65 0.34
66 0.33
67 0.35
68 0.37
69 0.43
70 0.49
71 0.54
72 0.54
73 0.59
74 0.6
75 0.64
76 0.71
77 0.7
78 0.72
79 0.71
80 0.65
81 0.58
82 0.57
83 0.49
84 0.39
85 0.35
86 0.27
87 0.18
88 0.15