Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JWU1

Protein Details
Accession A0A5M9JWU1   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-105HPPSKIKAVNRRPAKKQKRSRPRSESDEEBasic
NLS Segment(s)
PositionSequence
74-99KKTHPPSKIKAVNRRPAKKQKRSRPR
129-140RSLPRRKAKSKS
Subcellular Location(s) cyto 3.5, cyto_nucl 13, nucl 21.5
Family & Domain DBs
Amino Acid Sequences MSADAEKQKLMASILSQVNIGHIDWDRVAKDLNTPTANAARVRWQRFRKTLPTFDNGPNGDSYHGTSSPPVTPKKTHPPSKIKAVNRRPAKKQKRSRPRSESDEEDDELQLDIYDKEESKYAPMERPVRSLPRRKAKSKSPIKEAITSEEGEEDDNEINVGMKCEDPDEDNICCAGTQETHTTINGGRAFVDSGSDFDGSLDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.18
5 0.19
6 0.18
7 0.17
8 0.12
9 0.11
10 0.13
11 0.13
12 0.16
13 0.15
14 0.15
15 0.17
16 0.14
17 0.19
18 0.22
19 0.26
20 0.25
21 0.25
22 0.27
23 0.29
24 0.31
25 0.26
26 0.24
27 0.28
28 0.35
29 0.41
30 0.47
31 0.51
32 0.58
33 0.64
34 0.7
35 0.7
36 0.7
37 0.73
38 0.69
39 0.65
40 0.61
41 0.57
42 0.57
43 0.48
44 0.41
45 0.33
46 0.28
47 0.24
48 0.2
49 0.18
50 0.14
51 0.14
52 0.13
53 0.13
54 0.15
55 0.17
56 0.21
57 0.23
58 0.23
59 0.26
60 0.33
61 0.43
62 0.5
63 0.55
64 0.6
65 0.66
66 0.67
67 0.74
68 0.75
69 0.72
70 0.73
71 0.74
72 0.74
73 0.74
74 0.76
75 0.75
76 0.78
77 0.81
78 0.81
79 0.82
80 0.84
81 0.86
82 0.89
83 0.9
84 0.87
85 0.83
86 0.8
87 0.74
88 0.68
89 0.62
90 0.55
91 0.45
92 0.37
93 0.3
94 0.23
95 0.18
96 0.13
97 0.08
98 0.06
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.08
105 0.08
106 0.09
107 0.12
108 0.13
109 0.15
110 0.21
111 0.27
112 0.27
113 0.31
114 0.33
115 0.39
116 0.44
117 0.51
118 0.54
119 0.59
120 0.65
121 0.68
122 0.72
123 0.72
124 0.76
125 0.77
126 0.75
127 0.72
128 0.73
129 0.7
130 0.7
131 0.62
132 0.56
133 0.48
134 0.41
135 0.33
136 0.25
137 0.22
138 0.16
139 0.15
140 0.11
141 0.09
142 0.08
143 0.08
144 0.07
145 0.08
146 0.08
147 0.09
148 0.08
149 0.08
150 0.08
151 0.1
152 0.11
153 0.11
154 0.16
155 0.18
156 0.18
157 0.18
158 0.18
159 0.17
160 0.16
161 0.15
162 0.12
163 0.1
164 0.12
165 0.15
166 0.18
167 0.2
168 0.2
169 0.21
170 0.2
171 0.26
172 0.24
173 0.21
174 0.18
175 0.18
176 0.19
177 0.17
178 0.19
179 0.13
180 0.12
181 0.15
182 0.14
183 0.13