Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K3B1

Protein Details
Accession A0A5M9K3B1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-79NRGIHTKRAGKKVREREREGGREBasic
NLS Segment(s)
PositionSequence
61-77HTKRAGKKVREREREGG
Subcellular Location(s) mito 11, cysk 7, cyto 5, nucl 4
Family & Domain DBs
Amino Acid Sequences MGGWVLKSIRFDSIRFIPFRAIPFHSMLLAIHHHPSIHPSPDADQRSNENTCRREMNRGIHTKRAGKKVREREREGGREGERENEYTQVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.36
4 0.32
5 0.33
6 0.35
7 0.33
8 0.28
9 0.25
10 0.27
11 0.26
12 0.23
13 0.2
14 0.18
15 0.16
16 0.15
17 0.13
18 0.12
19 0.12
20 0.11
21 0.11
22 0.16
23 0.17
24 0.17
25 0.16
26 0.15
27 0.18
28 0.26
29 0.29
30 0.25
31 0.24
32 0.24
33 0.28
34 0.3
35 0.31
36 0.29
37 0.27
38 0.28
39 0.33
40 0.32
41 0.35
42 0.38
43 0.42
44 0.45
45 0.53
46 0.54
47 0.55
48 0.59
49 0.59
50 0.61
51 0.63
52 0.62
53 0.61
54 0.69
55 0.73
56 0.79
57 0.8
58 0.81
59 0.8
60 0.81
61 0.78
62 0.72
63 0.68
64 0.6
65 0.56
66 0.49
67 0.47
68 0.4
69 0.37
70 0.34