Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K264

Protein Details
Accession A0A5M9K264    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
95-115PSTHYSMKQSINKRKPTQTYRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7.5, cyto_nucl 7.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004898  Pectate_lyase_PlyH/PlyE-like  
IPR012334  Pectin_lyas_fold  
IPR011050  Pectin_lyase_fold/virulence  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030570  F:pectate lyase activity  
Pfam View protein in Pfam  
PF03211  Pectate_lyase  
Amino Acid Sequences MASNPTTLTCLGYTGGIPTSTLTKTNSKVIEVAAGATFDGGWVKCDHGPGACNDQVEGGDSNAFFILHSRATLQNLIIDYIPLSLHRHRFSLITPSTHYSMKQSINKRKPTQTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.1
4 0.1
5 0.1
6 0.12
7 0.13
8 0.14
9 0.16
10 0.2
11 0.22
12 0.29
13 0.29
14 0.27
15 0.27
16 0.25
17 0.24
18 0.19
19 0.17
20 0.11
21 0.1
22 0.09
23 0.08
24 0.07
25 0.05
26 0.06
27 0.05
28 0.06
29 0.06
30 0.08
31 0.09
32 0.1
33 0.11
34 0.1
35 0.11
36 0.12
37 0.17
38 0.17
39 0.16
40 0.15
41 0.15
42 0.14
43 0.14
44 0.13
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.04
52 0.05
53 0.06
54 0.06
55 0.06
56 0.08
57 0.09
58 0.11
59 0.12
60 0.11
61 0.12
62 0.12
63 0.13
64 0.11
65 0.1
66 0.08
67 0.08
68 0.08
69 0.07
70 0.1
71 0.14
72 0.21
73 0.22
74 0.23
75 0.24
76 0.25
77 0.26
78 0.32
79 0.31
80 0.28
81 0.29
82 0.32
83 0.34
84 0.34
85 0.33
86 0.28
87 0.31
88 0.35
89 0.4
90 0.47
91 0.56
92 0.64
93 0.74
94 0.77
95 0.8