Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JBM1

Protein Details
Accession A0A5M9JBM1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-74LLKIAVPKRTGRKRKRGSQDPYTNDVHydrophilic
NLS Segment(s)
PositionSequence
55-64PKRTGRKRKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019136  TF_IIIC_su-5_HTH  
IPR040454  TF_IIIC_Tfc1/Sfc1  
IPR041499  Tfc1/Sfc1_N  
IPR042536  TFIIIC_tauA_Sfc1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000127  C:transcription factor TFIIIC complex  
GO:0003677  F:DNA binding  
GO:0006384  P:transcription initiation at RNA polymerase III promoter  
Pfam View protein in Pfam  
PF09734  Tau95  
PF17682  Tau95_N  
Amino Acid Sequences MVSRLLDVNHNGTRFLRELKDECIPLFLRIRDPTCEPILSYNSITNNVLLKIAVPKRTGRKRKRGSQDPYTNDVDPKSTTISGENSTSNIQSHSLNDKPTSILKKLRDNVGKYTVEAVGAIEQSHRYRGLADYHQSTSHAPFMSHFQETAFSANLTRAGSRNEEIVPPPTFTHHPLPFNWGYRQNPLISTEVDAETGETSIVNRSKMPKLEMQYVHCDEDEDVPTKAHRPVPDDPVLKDFVAALQQAMNERPIWTRRALQNRLVNEPGYYLMKTRPSIRRLPIPKWPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.28
4 0.3
5 0.33
6 0.36
7 0.41
8 0.38
9 0.36
10 0.36
11 0.33
12 0.31
13 0.34
14 0.31
15 0.31
16 0.35
17 0.37
18 0.36
19 0.39
20 0.4
21 0.38
22 0.37
23 0.31
24 0.31
25 0.31
26 0.3
27 0.28
28 0.27
29 0.25
30 0.27
31 0.26
32 0.23
33 0.22
34 0.19
35 0.18
36 0.14
37 0.13
38 0.19
39 0.23
40 0.26
41 0.26
42 0.32
43 0.42
44 0.53
45 0.63
46 0.65
47 0.72
48 0.77
49 0.85
50 0.9
51 0.9
52 0.88
53 0.88
54 0.87
55 0.82
56 0.78
57 0.72
58 0.62
59 0.53
60 0.45
61 0.36
62 0.27
63 0.22
64 0.19
65 0.16
66 0.15
67 0.16
68 0.18
69 0.18
70 0.19
71 0.17
72 0.16
73 0.17
74 0.17
75 0.15
76 0.13
77 0.13
78 0.11
79 0.14
80 0.18
81 0.19
82 0.21
83 0.21
84 0.21
85 0.21
86 0.26
87 0.27
88 0.26
89 0.3
90 0.32
91 0.4
92 0.43
93 0.5
94 0.51
95 0.49
96 0.5
97 0.51
98 0.47
99 0.39
100 0.37
101 0.29
102 0.22
103 0.19
104 0.15
105 0.08
106 0.08
107 0.07
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.08
114 0.09
115 0.11
116 0.15
117 0.16
118 0.19
119 0.21
120 0.21
121 0.22
122 0.22
123 0.21
124 0.18
125 0.17
126 0.15
127 0.12
128 0.11
129 0.15
130 0.16
131 0.15
132 0.14
133 0.11
134 0.12
135 0.12
136 0.13
137 0.1
138 0.07
139 0.07
140 0.07
141 0.09
142 0.08
143 0.09
144 0.08
145 0.1
146 0.12
147 0.12
148 0.14
149 0.13
150 0.14
151 0.15
152 0.17
153 0.17
154 0.16
155 0.15
156 0.16
157 0.17
158 0.2
159 0.26
160 0.26
161 0.27
162 0.26
163 0.33
164 0.33
165 0.35
166 0.35
167 0.34
168 0.32
169 0.34
170 0.35
171 0.3
172 0.28
173 0.27
174 0.25
175 0.19
176 0.19
177 0.17
178 0.15
179 0.14
180 0.13
181 0.11
182 0.09
183 0.09
184 0.07
185 0.05
186 0.05
187 0.09
188 0.11
189 0.12
190 0.13
191 0.18
192 0.22
193 0.25
194 0.28
195 0.3
196 0.32
197 0.41
198 0.43
199 0.42
200 0.46
201 0.46
202 0.44
203 0.38
204 0.34
205 0.26
206 0.26
207 0.25
208 0.2
209 0.17
210 0.16
211 0.17
212 0.19
213 0.23
214 0.23
215 0.23
216 0.27
217 0.31
218 0.38
219 0.46
220 0.46
221 0.43
222 0.42
223 0.42
224 0.36
225 0.31
226 0.24
227 0.16
228 0.16
229 0.14
230 0.11
231 0.1
232 0.11
233 0.13
234 0.14
235 0.14
236 0.12
237 0.14
238 0.18
239 0.2
240 0.23
241 0.24
242 0.31
243 0.38
244 0.48
245 0.52
246 0.56
247 0.6
248 0.61
249 0.64
250 0.59
251 0.51
252 0.41
253 0.37
254 0.31
255 0.27
256 0.23
257 0.19
258 0.21
259 0.26
260 0.29
261 0.36
262 0.42
263 0.45
264 0.53
265 0.58
266 0.64
267 0.65
268 0.69
269 0.7