Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5M9K847

Protein Details
Accession A0A5M9K847    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-30ALTIHHPPPRPRKPTHPSNPPPRTQDPHydrophilic
NLS Segment(s)
PositionSequence
66-73PRRRARNR
126-136APRRRSGGRVA
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015419  CTAG/Pcc1  
Pfam View protein in Pfam  
PF09341  Pcc1  
Amino Acid Sequences MHHALTIHHPPPRPRKPTHPSNPPPRTQDPRPPLPTARLATAALSALTVDAELSPSSAAPSPSPAPRRRARNRPPSSAPPTTQRPTACCASPSTASWRASPSSSASWRSSTEMCSRAPPGSAERNAPRRRSGGRVAHPPRSPGRCTHGASCKAGTRRWGFGDDGVFFGDVKSWVWPCARDIEAGAATSHTVFPIASKICRRDIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.76
4 0.82
5 0.83
6 0.84
7 0.83
8 0.87
9 0.88
10 0.84
11 0.83
12 0.8
13 0.78
14 0.74
15 0.75
16 0.72
17 0.74
18 0.72
19 0.69
20 0.64
21 0.61
22 0.61
23 0.52
24 0.46
25 0.38
26 0.33
27 0.29
28 0.26
29 0.21
30 0.13
31 0.11
32 0.08
33 0.06
34 0.05
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.08
45 0.09
46 0.08
47 0.12
48 0.15
49 0.21
50 0.29
51 0.32
52 0.38
53 0.44
54 0.55
55 0.6
56 0.69
57 0.72
58 0.76
59 0.78
60 0.79
61 0.79
62 0.77
63 0.76
64 0.69
65 0.61
66 0.56
67 0.56
68 0.5
69 0.48
70 0.4
71 0.34
72 0.33
73 0.34
74 0.28
75 0.22
76 0.22
77 0.21
78 0.21
79 0.2
80 0.22
81 0.26
82 0.26
83 0.26
84 0.26
85 0.24
86 0.23
87 0.23
88 0.19
89 0.17
90 0.18
91 0.21
92 0.2
93 0.21
94 0.21
95 0.23
96 0.21
97 0.2
98 0.22
99 0.21
100 0.2
101 0.21
102 0.21
103 0.19
104 0.19
105 0.17
106 0.18
107 0.21
108 0.22
109 0.25
110 0.3
111 0.39
112 0.43
113 0.45
114 0.43
115 0.42
116 0.43
117 0.44
118 0.47
119 0.46
120 0.48
121 0.56
122 0.58
123 0.61
124 0.59
125 0.58
126 0.56
127 0.52
128 0.48
129 0.41
130 0.43
131 0.42
132 0.44
133 0.47
134 0.49
135 0.48
136 0.49
137 0.47
138 0.46
139 0.43
140 0.42
141 0.42
142 0.37
143 0.37
144 0.37
145 0.37
146 0.32
147 0.31
148 0.33
149 0.26
150 0.23
151 0.2
152 0.17
153 0.15
154 0.13
155 0.12
156 0.09
157 0.09
158 0.11
159 0.11
160 0.14
161 0.16
162 0.17
163 0.18
164 0.23
165 0.23
166 0.21
167 0.21
168 0.23
169 0.22
170 0.22
171 0.2
172 0.15
173 0.14
174 0.14
175 0.13
176 0.08
177 0.08
178 0.07
179 0.08
180 0.14
181 0.17
182 0.22
183 0.29
184 0.33
185 0.41