Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9K799

Protein Details
Accession A0A5M9K799   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-86DWFRNLPPNPRRPKIRHNPRPQLQTPPRHydrophilic
NLS Segment(s)
PositionSequence
69-74RRPKIR
Subcellular Location(s) cyto 4.5, cyto_nucl 11.5, mito 2, nucl 17.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MDSPKFAQFDISVVTFKTVQNHDIQTYILIPKNISPGPHPVIVKIHGGGSVAGSGIQPDWFRNLPPNPRRPKIRHNPRPQLQTPPRIQRARNDLRHQHLLVLAPQPLPPRLSPPHLTPSLTHTLLYGDSAGGHLAVLSSLTQPEGTIRACIAAYPQLDIESPYFNTASEKHPFGSPMLPADLLTSHLASLNPDPTKRTLISETPNSQERLPLILVALQQGRYKGTLRLRRTRLSLPRLGEEDPGGGKAKLTLFVDLSWGEGYATHTNHPPDNHHDNYSTVAPHVPREMNPSHPRDRNVLHALQAHLMGPVPEPKLKKQLGDARDWAVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.19
4 0.25
5 0.23
6 0.24
7 0.29
8 0.33
9 0.31
10 0.3
11 0.29
12 0.23
13 0.24
14 0.26
15 0.23
16 0.2
17 0.2
18 0.21
19 0.27
20 0.27
21 0.26
22 0.24
23 0.29
24 0.32
25 0.36
26 0.34
27 0.31
28 0.33
29 0.34
30 0.34
31 0.27
32 0.23
33 0.19
34 0.19
35 0.16
36 0.13
37 0.11
38 0.08
39 0.08
40 0.07
41 0.07
42 0.06
43 0.08
44 0.08
45 0.09
46 0.14
47 0.14
48 0.15
49 0.23
50 0.29
51 0.38
52 0.47
53 0.56
54 0.61
55 0.67
56 0.76
57 0.75
58 0.8
59 0.8
60 0.83
61 0.83
62 0.85
63 0.89
64 0.87
65 0.89
66 0.81
67 0.81
68 0.77
69 0.76
70 0.73
71 0.72
72 0.73
73 0.69
74 0.68
75 0.64
76 0.67
77 0.68
78 0.69
79 0.68
80 0.66
81 0.67
82 0.71
83 0.64
84 0.54
85 0.46
86 0.39
87 0.33
88 0.28
89 0.23
90 0.17
91 0.19
92 0.19
93 0.19
94 0.19
95 0.16
96 0.2
97 0.22
98 0.27
99 0.28
100 0.3
101 0.35
102 0.35
103 0.36
104 0.3
105 0.33
106 0.33
107 0.31
108 0.26
109 0.2
110 0.19
111 0.18
112 0.17
113 0.11
114 0.06
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.1
147 0.08
148 0.08
149 0.08
150 0.09
151 0.08
152 0.09
153 0.1
154 0.13
155 0.14
156 0.15
157 0.15
158 0.15
159 0.16
160 0.16
161 0.16
162 0.13
163 0.11
164 0.11
165 0.1
166 0.1
167 0.1
168 0.08
169 0.09
170 0.09
171 0.07
172 0.07
173 0.08
174 0.08
175 0.08
176 0.1
177 0.13
178 0.14
179 0.14
180 0.16
181 0.17
182 0.2
183 0.2
184 0.21
185 0.2
186 0.23
187 0.27
188 0.32
189 0.33
190 0.32
191 0.35
192 0.34
193 0.3
194 0.28
195 0.23
196 0.2
197 0.17
198 0.14
199 0.11
200 0.12
201 0.12
202 0.12
203 0.13
204 0.12
205 0.12
206 0.13
207 0.14
208 0.13
209 0.14
210 0.18
211 0.26
212 0.34
213 0.4
214 0.5
215 0.54
216 0.57
217 0.6
218 0.63
219 0.63
220 0.62
221 0.6
222 0.54
223 0.52
224 0.5
225 0.46
226 0.39
227 0.3
228 0.24
229 0.19
230 0.18
231 0.16
232 0.13
233 0.12
234 0.13
235 0.13
236 0.15
237 0.16
238 0.16
239 0.15
240 0.15
241 0.17
242 0.14
243 0.15
244 0.11
245 0.1
246 0.08
247 0.08
248 0.12
249 0.15
250 0.16
251 0.17
252 0.2
253 0.23
254 0.26
255 0.27
256 0.28
257 0.32
258 0.39
259 0.41
260 0.4
261 0.39
262 0.37
263 0.38
264 0.36
265 0.28
266 0.21
267 0.22
268 0.2
269 0.2
270 0.24
271 0.23
272 0.22
273 0.28
274 0.3
275 0.36
276 0.43
277 0.49
278 0.52
279 0.56
280 0.57
281 0.57
282 0.57
283 0.56
284 0.54
285 0.5
286 0.45
287 0.44
288 0.42
289 0.37
290 0.35
291 0.27
292 0.21
293 0.19
294 0.15
295 0.12
296 0.16
297 0.18
298 0.22
299 0.26
300 0.3
301 0.4
302 0.42
303 0.43
304 0.48
305 0.53
306 0.54
307 0.58
308 0.56
309 0.5