Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8SUU1

Protein Details
Accession Q8SUU1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MGKLFKKFRIEKANERKKAKEKPKIKKTQEIRSHIREBasic
NLS Segment(s)
PositionSequence
6-28KKFRIEKANERKKAKEKPKIKKT
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG ecu:ECU08_0100  -  
Amino Acid Sequences MGKLFKKFRIEKANERKKAKEKPKIKKTQEIRSHIRERSEIEKIFCCLDVSYRRRTGYRKIIGLNEAELEKNIFLVLEKVLEVVVTFDPVDSLFYSVLKRVLRLRNSVSIHPLLIDYFFASVLCGASYEDFGFFLLKNSPQLLVSNKDKILARLPDGELKSKISELKPRNRCPSIEYQQKFVILKDKVLIDDRRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.82
4 0.81
5 0.84
6 0.84
7 0.83
8 0.82
9 0.85
10 0.9
11 0.92
12 0.89
13 0.89
14 0.86
15 0.87
16 0.86
17 0.83
18 0.8
19 0.79
20 0.79
21 0.73
22 0.68
23 0.59
24 0.53
25 0.51
26 0.5
27 0.44
28 0.39
29 0.38
30 0.35
31 0.34
32 0.3
33 0.25
34 0.17
35 0.2
36 0.26
37 0.28
38 0.34
39 0.37
40 0.39
41 0.42
42 0.46
43 0.49
44 0.5
45 0.53
46 0.5
47 0.49
48 0.5
49 0.48
50 0.45
51 0.36
52 0.27
53 0.21
54 0.16
55 0.13
56 0.11
57 0.08
58 0.07
59 0.06
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.06
78 0.05
79 0.06
80 0.05
81 0.06
82 0.07
83 0.07
84 0.11
85 0.1
86 0.11
87 0.17
88 0.23
89 0.25
90 0.29
91 0.31
92 0.35
93 0.38
94 0.37
95 0.34
96 0.29
97 0.26
98 0.22
99 0.19
100 0.12
101 0.1
102 0.09
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.06
121 0.07
122 0.09
123 0.09
124 0.11
125 0.11
126 0.12
127 0.12
128 0.14
129 0.16
130 0.2
131 0.24
132 0.27
133 0.27
134 0.3
135 0.3
136 0.29
137 0.33
138 0.3
139 0.29
140 0.28
141 0.3
142 0.33
143 0.35
144 0.37
145 0.31
146 0.3
147 0.29
148 0.27
149 0.3
150 0.27
151 0.35
152 0.4
153 0.49
154 0.57
155 0.65
156 0.72
157 0.71
158 0.68
159 0.65
160 0.67
161 0.66
162 0.67
163 0.6
164 0.56
165 0.55
166 0.58
167 0.52
168 0.43
169 0.42
170 0.33
171 0.33
172 0.32
173 0.31
174 0.29
175 0.35
176 0.37