Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9KA59

Protein Details
Accession A0A5M9KA59   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-44MVNGPRVDTKLRRKKKNRSSQTPLSKRKGSHydrophilic
52-73SPKPCLSDKRYHKKQSYPTLSPHydrophilic
NLS Segment(s)
PositionSequence
24-41KLRRKKKNRSSQTPLSKR
Subcellular Location(s) cyto 5.5, cyto_nucl 11.5, mito 5, nucl 16.5
Family & Domain DBs
Amino Acid Sequences MVNGQWSMVNGQWSMVNGPRVDTKLRRKKKNRSSQTPLSKRKGSQVFGLGDSPKPCLSDKRYHKKQSYPTLSPKSPILP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.16
5 0.18
6 0.2
7 0.22
8 0.26
9 0.31
10 0.39
11 0.47
12 0.56
13 0.65
14 0.72
15 0.81
16 0.87
17 0.9
18 0.9
19 0.89
20 0.88
21 0.87
22 0.89
23 0.88
24 0.85
25 0.8
26 0.73
27 0.64
28 0.63
29 0.58
30 0.49
31 0.42
32 0.39
33 0.35
34 0.32
35 0.34
36 0.26
37 0.23
38 0.22
39 0.21
40 0.16
41 0.16
42 0.16
43 0.21
44 0.26
45 0.34
46 0.45
47 0.54
48 0.64
49 0.72
50 0.77
51 0.79
52 0.83
53 0.84
54 0.83
55 0.79
56 0.79
57 0.79
58 0.74
59 0.68