Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5M9JX14

Protein Details
Accession A0A5M9JX14   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
105-124ISIGREKKAKKKGLDHTLFSHydrophilic
NLS Segment(s)
PositionSequence
111-116KKAKKK
Subcellular Location(s) cyto 2, mito 3, nucl 14, pero 3, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRFEDSNRYNLTALRLAPDKDHDDVQVDGPKKSWKAAICSAEPRRCSLYTPQYGLSSSIILSIPTISILSFAAAYVHKYNLGSHTSPRPSSLIPHPSSLTIMDISIGREKKAKKKGLDHTLFSWTRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.26
4 0.25
5 0.26
6 0.29
7 0.28
8 0.26
9 0.27
10 0.24
11 0.23
12 0.23
13 0.24
14 0.26
15 0.24
16 0.22
17 0.22
18 0.26
19 0.24
20 0.25
21 0.26
22 0.22
23 0.27
24 0.34
25 0.37
26 0.36
27 0.44
28 0.5
29 0.51
30 0.49
31 0.45
32 0.42
33 0.38
34 0.37
35 0.36
36 0.37
37 0.36
38 0.38
39 0.37
40 0.33
41 0.33
42 0.31
43 0.24
44 0.15
45 0.11
46 0.1
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.03
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.07
63 0.08
64 0.08
65 0.09
66 0.09
67 0.1
68 0.12
69 0.16
70 0.15
71 0.17
72 0.25
73 0.28
74 0.28
75 0.29
76 0.28
77 0.25
78 0.28
79 0.33
80 0.35
81 0.33
82 0.35
83 0.34
84 0.33
85 0.33
86 0.29
87 0.23
88 0.14
89 0.12
90 0.1
91 0.1
92 0.11
93 0.17
94 0.17
95 0.17
96 0.22
97 0.28
98 0.37
99 0.46
100 0.53
101 0.54
102 0.64
103 0.73
104 0.78
105 0.8
106 0.75
107 0.69
108 0.7