Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R7M2

Protein Details
Accession A0A5B1R7M2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPSARGGDRSERRRRRRRRTAACWSSDEVHydrophilic
NLS Segment(s)
PositionSequence
8-19DRSERRRRRRRR
Subcellular Location(s) plas 8, nucl 7, mito 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MPSARGGDRSERRRRRRRRTAACWSSDEVARPSRALYPVFFLDVIILRAALVVVPRWRRRHYGLLPHTCAVYNVRDHSSGVRDDLDRGFRESEEISDAFNPQKHWTLPRLRGHGLLVRACCWRSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.93
4 0.94
5 0.94
6 0.94
7 0.94
8 0.93
9 0.87
10 0.8
11 0.72
12 0.63
13 0.54
14 0.46
15 0.38
16 0.32
17 0.27
18 0.23
19 0.21
20 0.22
21 0.23
22 0.21
23 0.19
24 0.19
25 0.18
26 0.19
27 0.18
28 0.14
29 0.12
30 0.12
31 0.11
32 0.08
33 0.07
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.09
41 0.16
42 0.22
43 0.26
44 0.29
45 0.33
46 0.37
47 0.45
48 0.46
49 0.51
50 0.54
51 0.57
52 0.57
53 0.53
54 0.49
55 0.39
56 0.34
57 0.26
58 0.19
59 0.14
60 0.14
61 0.15
62 0.15
63 0.16
64 0.17
65 0.18
66 0.16
67 0.15
68 0.15
69 0.14
70 0.15
71 0.17
72 0.19
73 0.18
74 0.19
75 0.19
76 0.17
77 0.19
78 0.17
79 0.16
80 0.16
81 0.15
82 0.14
83 0.14
84 0.15
85 0.16
86 0.17
87 0.18
88 0.18
89 0.22
90 0.23
91 0.27
92 0.34
93 0.41
94 0.48
95 0.54
96 0.58
97 0.55
98 0.55
99 0.55
100 0.52
101 0.48
102 0.44
103 0.37
104 0.33
105 0.36
106 0.34