Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VWK0

Protein Details
Accession H1VWK0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ETSAKIPRIRHNSRPRRTTNRICLPHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences METSAKIPRIRHNSRPRRTTNRICLPHIICRPIENPLSCAIHGAGSKRTSLDQNQSYDTARTRVHSAYDAYDVDIGLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.84
4 0.84
5 0.86
6 0.85
7 0.85
8 0.84
9 0.8
10 0.74
11 0.72
12 0.65
13 0.64
14 0.57
15 0.49
16 0.39
17 0.36
18 0.34
19 0.3
20 0.31
21 0.22
22 0.2
23 0.2
24 0.21
25 0.19
26 0.18
27 0.15
28 0.13
29 0.13
30 0.14
31 0.14
32 0.13
33 0.14
34 0.14
35 0.15
36 0.17
37 0.2
38 0.26
39 0.27
40 0.29
41 0.31
42 0.32
43 0.32
44 0.31
45 0.29
46 0.25
47 0.21
48 0.21
49 0.22
50 0.22
51 0.23
52 0.24
53 0.24
54 0.23
55 0.25
56 0.24
57 0.21
58 0.21