Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VM34

Protein Details
Accession H1VM34   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
275-311KEGRILPYKPCPKRGRRRRPRRKKANYDIWPTRKRAABasic
NLS Segment(s)
PositionSequence
253-301PKRRFVPSKHEAKRIAKLVKAIKEGRILPYKPCPKRGRRRRPRRKKANY
306-309TRKR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028598  BOP1/Erb1  
IPR012953  BOP1_N_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08145  BOP1NT  
Amino Acid Sequences MPARQALGKRKEPQAEAPVPVDDEFGNAALEGVFSQSEDDSDYEETSESDGDDNVLNGELSEDDDEDEEEDILSDDIPSDVDDEEIASKLRSTNLDKDSAAAAIGDEDDQPNYRIVKDANGNERYEYDEVDPNYDSDDTDAAEPVNTIGNIPLSFYDSYPHIGYDINGKKIMRPAAGEALDALLDSIEIPKGWTGLTDPQTGKPLNLTQDELELLRRVQMNEVPEEGYDPYPEMVHWFTAHEEKMPLSAAPEPKRRFVPSKHEAKRIAKLVKAIKEGRILPYKPCPKRGRRRRPRRKKANYDIWPTRKRAAARHAFSTKSAISANDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.64
3 0.58
4 0.53
5 0.46
6 0.41
7 0.37
8 0.3
9 0.2
10 0.16
11 0.14
12 0.12
13 0.1
14 0.08
15 0.08
16 0.07
17 0.07
18 0.06
19 0.06
20 0.05
21 0.05
22 0.07
23 0.06
24 0.07
25 0.09
26 0.09
27 0.1
28 0.12
29 0.12
30 0.12
31 0.12
32 0.12
33 0.11
34 0.11
35 0.09
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.08
43 0.07
44 0.06
45 0.07
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.08
74 0.07
75 0.07
76 0.08
77 0.1
78 0.14
79 0.18
80 0.26
81 0.28
82 0.32
83 0.31
84 0.31
85 0.29
86 0.25
87 0.2
88 0.12
89 0.09
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.1
99 0.1
100 0.1
101 0.11
102 0.11
103 0.15
104 0.2
105 0.25
106 0.31
107 0.33
108 0.34
109 0.32
110 0.33
111 0.32
112 0.26
113 0.22
114 0.16
115 0.18
116 0.17
117 0.19
118 0.18
119 0.15
120 0.16
121 0.14
122 0.12
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.06
131 0.05
132 0.06
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.08
142 0.08
143 0.09
144 0.09
145 0.11
146 0.11
147 0.1
148 0.09
149 0.08
150 0.08
151 0.17
152 0.19
153 0.19
154 0.2
155 0.2
156 0.21
157 0.24
158 0.26
159 0.18
160 0.16
161 0.16
162 0.19
163 0.19
164 0.18
165 0.14
166 0.12
167 0.11
168 0.1
169 0.08
170 0.03
171 0.02
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.06
182 0.12
183 0.15
184 0.2
185 0.21
186 0.22
187 0.26
188 0.26
189 0.25
190 0.21
191 0.21
192 0.19
193 0.2
194 0.2
195 0.16
196 0.17
197 0.18
198 0.16
199 0.14
200 0.11
201 0.1
202 0.11
203 0.13
204 0.12
205 0.13
206 0.16
207 0.17
208 0.17
209 0.18
210 0.16
211 0.14
212 0.15
213 0.15
214 0.13
215 0.11
216 0.1
217 0.09
218 0.09
219 0.09
220 0.1
221 0.1
222 0.1
223 0.1
224 0.1
225 0.12
226 0.16
227 0.16
228 0.15
229 0.15
230 0.14
231 0.15
232 0.15
233 0.13
234 0.11
235 0.16
236 0.22
237 0.28
238 0.37
239 0.39
240 0.42
241 0.46
242 0.5
243 0.52
244 0.52
245 0.55
246 0.56
247 0.64
248 0.67
249 0.71
250 0.73
251 0.72
252 0.73
253 0.71
254 0.66
255 0.58
256 0.58
257 0.57
258 0.56
259 0.58
260 0.52
261 0.48
262 0.49
263 0.49
264 0.48
265 0.49
266 0.44
267 0.42
268 0.49
269 0.56
270 0.56
271 0.64
272 0.67
273 0.69
274 0.8
275 0.86
276 0.87
277 0.88
278 0.94
279 0.95
280 0.97
281 0.97
282 0.98
283 0.97
284 0.97
285 0.97
286 0.96
287 0.94
288 0.93
289 0.93
290 0.91
291 0.87
292 0.8
293 0.74
294 0.69
295 0.63
296 0.61
297 0.61
298 0.62
299 0.59
300 0.64
301 0.65
302 0.61
303 0.59
304 0.56
305 0.46
306 0.38
307 0.34