Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RA88

Protein Details
Accession A0A5B1RA88    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
195-224CASHSRRASRLRRRASRLRRRASRLCHRPYHydrophilic
261-281APPSCASRLRRRASRIRRAIAHydrophilic
NLS Segment(s)
PositionSequence
200-253RRASRLRRRASRLRRRASRLCHRPYAPPSRPYAPPSRPSPLRVTPTRRRRASRP
270-279RRRASRIRRA
Subcellular Location(s) mito 17, nucl 7, cyto 1, plas 1, extr 1
Family & Domain DBs
Amino Acid Sequences MPTFLPAHPCPFSGSRLAFLARSRLHAALPFPCARPSSRVRAPSCVWAFSRPPRHALVAPSHARAPSCPLRASRPVSRPHHALVASRRVCAPAHPRALVPVHLRAVALSRPSRPLRAVAPLLFHLVLVHVRPPPRPRALAPSCPSRRHPIVAFPPSAPLGHQARRAVAAFVPLAPLHISAGALAPSSRPYAPPSCASHSRRASRLRRRASRLRRRASRLCHRPYAPPSRPYAPPSRPSPLRVTPTRRRRASRPAPSSCPYAPPSCASRLRRRASRIRRAIAPVVPLPPRLAPTRRLRSRCAVACLGRFSRALVSPLRVSILRLTQLSHRCASRLVPRRLALSHACILVYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.32
4 0.33
5 0.3
6 0.29
7 0.34
8 0.28
9 0.31
10 0.32
11 0.3
12 0.3
13 0.31
14 0.33
15 0.28
16 0.33
17 0.32
18 0.3
19 0.32
20 0.32
21 0.32
22 0.35
23 0.37
24 0.4
25 0.45
26 0.52
27 0.53
28 0.58
29 0.58
30 0.61
31 0.57
32 0.52
33 0.46
34 0.43
35 0.46
36 0.48
37 0.55
38 0.47
39 0.48
40 0.47
41 0.5
42 0.47
43 0.46
44 0.44
45 0.43
46 0.44
47 0.43
48 0.42
49 0.38
50 0.36
51 0.31
52 0.32
53 0.31
54 0.31
55 0.33
56 0.33
57 0.39
58 0.46
59 0.52
60 0.53
61 0.52
62 0.58
63 0.6
64 0.63
65 0.6
66 0.54
67 0.54
68 0.46
69 0.45
70 0.42
71 0.47
72 0.42
73 0.4
74 0.38
75 0.34
76 0.33
77 0.33
78 0.33
79 0.31
80 0.35
81 0.35
82 0.34
83 0.36
84 0.38
85 0.37
86 0.32
87 0.28
88 0.24
89 0.24
90 0.23
91 0.2
92 0.2
93 0.18
94 0.19
95 0.17
96 0.18
97 0.24
98 0.26
99 0.29
100 0.27
101 0.28
102 0.26
103 0.29
104 0.31
105 0.25
106 0.26
107 0.24
108 0.25
109 0.22
110 0.19
111 0.13
112 0.1
113 0.1
114 0.08
115 0.1
116 0.11
117 0.12
118 0.17
119 0.21
120 0.26
121 0.3
122 0.32
123 0.32
124 0.39
125 0.43
126 0.48
127 0.48
128 0.52
129 0.53
130 0.54
131 0.54
132 0.51
133 0.48
134 0.43
135 0.41
136 0.38
137 0.42
138 0.43
139 0.42
140 0.35
141 0.34
142 0.3
143 0.29
144 0.21
145 0.17
146 0.17
147 0.19
148 0.22
149 0.21
150 0.21
151 0.23
152 0.23
153 0.19
154 0.15
155 0.13
156 0.1
157 0.09
158 0.09
159 0.07
160 0.07
161 0.07
162 0.07
163 0.05
164 0.05
165 0.05
166 0.04
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.05
173 0.07
174 0.07
175 0.08
176 0.11
177 0.14
178 0.16
179 0.21
180 0.24
181 0.27
182 0.36
183 0.39
184 0.44
185 0.48
186 0.5
187 0.52
188 0.58
189 0.63
190 0.65
191 0.71
192 0.72
193 0.74
194 0.78
195 0.82
196 0.84
197 0.85
198 0.85
199 0.84
200 0.83
201 0.83
202 0.83
203 0.82
204 0.81
205 0.8
206 0.76
207 0.74
208 0.67
209 0.67
210 0.67
211 0.68
212 0.63
213 0.57
214 0.55
215 0.53
216 0.54
217 0.51
218 0.52
219 0.47
220 0.47
221 0.48
222 0.51
223 0.5
224 0.5
225 0.53
226 0.5
227 0.52
228 0.54
229 0.57
230 0.6
231 0.68
232 0.74
233 0.74
234 0.73
235 0.73
236 0.76
237 0.78
238 0.79
239 0.78
240 0.75
241 0.74
242 0.71
243 0.7
244 0.6
245 0.54
246 0.47
247 0.4
248 0.35
249 0.31
250 0.32
251 0.33
252 0.4
253 0.42
254 0.49
255 0.56
256 0.63
257 0.67
258 0.71
259 0.75
260 0.78
261 0.82
262 0.81
263 0.76
264 0.74
265 0.72
266 0.69
267 0.61
268 0.55
269 0.47
270 0.42
271 0.39
272 0.34
273 0.3
274 0.26
275 0.26
276 0.28
277 0.29
278 0.32
279 0.41
280 0.51
281 0.59
282 0.62
283 0.65
284 0.67
285 0.73
286 0.7
287 0.66
288 0.62
289 0.57
290 0.57
291 0.58
292 0.51
293 0.44
294 0.39
295 0.34
296 0.31
297 0.29
298 0.28
299 0.24
300 0.27
301 0.26
302 0.27
303 0.28
304 0.24
305 0.23
306 0.24
307 0.26
308 0.25
309 0.24
310 0.25
311 0.31
312 0.37
313 0.4
314 0.4
315 0.36
316 0.34
317 0.36
318 0.4
319 0.42
320 0.46
321 0.49
322 0.53
323 0.54
324 0.57
325 0.56
326 0.56
327 0.51
328 0.46
329 0.42
330 0.35