Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R4F1

Protein Details
Accession A0A5B1R4F1    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
137-160SNEERARKNKKARQQRDYRARDKGBasic
NLS Segment(s)
PositionSequence
111-119KGQKRKSRK
141-150RARKNKKARQ
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLHPSYDPHHDQYSAALESAFPHLHTPQIGRTAPVTGEFAYQGYTPANLATNFPHSSYSELANYAGDCRPADNAPGATQAAVAPGKLATPSSTHHGHMSECRASIAAPSAKGQKRKSRKGATDVSVVPRSEPLGGESNEERARKNKKARQQRDYRARDKGIVDELEDILPDGYKTNDPRAIRKKVARDLTEKNSRLEDTVKRYKTLLQDAENRYDCLYSKYNLTRNENKKLHRTIHTLEGGMRGLESGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.18
4 0.15
5 0.16
6 0.2
7 0.17
8 0.13
9 0.14
10 0.15
11 0.17
12 0.19
13 0.2
14 0.2
15 0.27
16 0.27
17 0.26
18 0.26
19 0.26
20 0.24
21 0.24
22 0.22
23 0.15
24 0.15
25 0.14
26 0.13
27 0.13
28 0.12
29 0.12
30 0.1
31 0.1
32 0.09
33 0.09
34 0.11
35 0.1
36 0.11
37 0.13
38 0.17
39 0.18
40 0.18
41 0.19
42 0.18
43 0.2
44 0.21
45 0.21
46 0.17
47 0.17
48 0.16
49 0.15
50 0.14
51 0.14
52 0.13
53 0.12
54 0.11
55 0.11
56 0.13
57 0.13
58 0.14
59 0.14
60 0.14
61 0.13
62 0.15
63 0.15
64 0.12
65 0.12
66 0.11
67 0.11
68 0.1
69 0.08
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.05
76 0.07
77 0.09
78 0.13
79 0.15
80 0.16
81 0.17
82 0.18
83 0.19
84 0.2
85 0.24
86 0.21
87 0.19
88 0.18
89 0.16
90 0.15
91 0.15
92 0.16
93 0.12
94 0.12
95 0.13
96 0.21
97 0.24
98 0.31
99 0.36
100 0.41
101 0.49
102 0.58
103 0.66
104 0.67
105 0.68
106 0.69
107 0.7
108 0.64
109 0.59
110 0.51
111 0.45
112 0.4
113 0.34
114 0.27
115 0.21
116 0.18
117 0.14
118 0.12
119 0.11
120 0.12
121 0.13
122 0.15
123 0.15
124 0.18
125 0.21
126 0.22
127 0.21
128 0.23
129 0.29
130 0.35
131 0.45
132 0.48
133 0.54
134 0.65
135 0.73
136 0.77
137 0.8
138 0.83
139 0.84
140 0.86
141 0.82
142 0.78
143 0.7
144 0.64
145 0.55
146 0.47
147 0.4
148 0.32
149 0.26
150 0.21
151 0.2
152 0.15
153 0.14
154 0.12
155 0.07
156 0.07
157 0.06
158 0.05
159 0.06
160 0.1
161 0.12
162 0.17
163 0.22
164 0.24
165 0.33
166 0.41
167 0.47
168 0.51
169 0.56
170 0.59
171 0.63
172 0.69
173 0.64
174 0.62
175 0.63
176 0.64
177 0.68
178 0.61
179 0.54
180 0.49
181 0.45
182 0.4
183 0.38
184 0.36
185 0.35
186 0.43
187 0.43
188 0.41
189 0.42
190 0.45
191 0.46
192 0.49
193 0.46
194 0.41
195 0.49
196 0.52
197 0.59
198 0.56
199 0.51
200 0.42
201 0.37
202 0.32
203 0.28
204 0.28
205 0.2
206 0.27
207 0.33
208 0.39
209 0.46
210 0.53
211 0.58
212 0.63
213 0.72
214 0.71
215 0.71
216 0.73
217 0.74
218 0.73
219 0.7
220 0.69
221 0.63
222 0.65
223 0.61
224 0.53
225 0.47
226 0.43
227 0.36
228 0.29
229 0.24
230 0.16