FuNGI

A0A5B1RD36

Protein Details

Accession

A0A5B1RD36

Localization Confidence

High

Confidence Score

16.5

NoLS Segment(s)

Position	Sequence	Protein Nature
117-140	PSPTHHRPLTPRRRPAPQRIPPPS	Hydrophilic
301-324	APSPRTPRHRYAPSPRRRAPRSPP	Basic

NLS Segment(s)

Position	Sequence
129-130	RR
305-322	RTPRHRYAPSPRRRAPRS

Subcellular Location(s)

nucl 15.5, mito 10, cyto_nucl 9

Family & Domain DBs

Amino Acid Sequences

MRTVGHSLRPRPPPHALSALHAPYAPYTALSSLSAASTRRPLPSPPSPPSPPPPRTLRAVRALSDTLRPPRGCASPPSSRAHSHLLVPQHAPPSSSRPYASHRCPFVRQRVPPPSPPSPTHHRPLTPRRRPAPQRIPPPSLRAQSHLLVPQHALTTALACPNVAYSCPNAAVSHPLPPSAAFSQPTAALACPPPPSHALPHMPSLTHRRPRSPTTVRCRQSLSAALRRRLLSSVALCHPLLHSRSPTAALARPPPSAALSYRSPLSRVLLPLLPPSHASAPGTSCSRSLLPAILLPSRALAPSPRTPRHRYAPSPRRRAPRSPPPAVVDVCGLRPALRRPVRTLHAPSAPSTRPLRTTRAVQAVDAPHAPSLCPPRAVHAVDAPHAQSSRPLRPPTAPLAPFAASAGRTRPPRAIDAVNAPHASSLRRLRPLNIPPLHP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.61
2	0.62
3	0.54
4	0.5
5	0.55
6	0.5
7	0.42
8	0.38
9	0.33
10	0.25
11	0.26
12	0.21
13	0.13
14	0.12
15	0.12
16	0.13
17	0.13
18	0.13
19	0.11
20	0.12
21	0.14
22	0.13
23	0.15
24	0.2
25	0.22
26	0.25
27	0.27
28	0.3
29	0.36
30	0.46
31	0.52
32	0.52
33	0.57
34	0.58
35	0.62
36	0.67
37	0.69
38	0.63
39	0.62
40	0.63
41	0.59
42	0.62
43	0.63
44	0.61
45	0.6
46	0.6
47	0.55
48	0.53
49	0.51
50	0.45
51	0.42
52	0.41
53	0.39
54	0.43
55	0.41
56	0.38
57	0.4
58	0.42
59	0.4
60	0.41
61	0.41
62	0.42
63	0.48
64	0.52
65	0.51
66	0.49
67	0.5
68	0.49
69	0.44
70	0.38
71	0.37
72	0.36
73	0.35
74	0.35
75	0.34
76	0.32
77	0.31
78	0.29
79	0.26
80	0.29
81	0.3
82	0.31
83	0.29
84	0.29
85	0.36
86	0.44
87	0.5
88	0.51
89	0.52
90	0.53
91	0.59
92	0.64
93	0.66
94	0.67
95	0.65
96	0.67
97	0.71
98	0.72
99	0.72
100	0.72
101	0.69
102	0.65
103	0.62
104	0.58
105	0.57
106	0.58
107	0.57
108	0.55
109	0.53
110	0.57
111	0.64
112	0.69
113	0.7
114	0.74
115	0.72
116	0.77
117	0.8
118	0.82
119	0.82
120	0.79
121	0.8
122	0.78
123	0.79
124	0.72
125	0.7
126	0.66
127	0.61
128	0.53
129	0.46
130	0.42
131	0.37
132	0.37
133	0.36
134	0.3
135	0.25
136	0.24
137	0.21
138	0.17
139	0.16
140	0.14
141	0.09
142	0.09
143	0.09
144	0.1
145	0.09
146	0.08
147	0.08
148	0.08
149	0.08
150	0.07
151	0.08
152	0.08
153	0.09
154	0.1
155	0.11
156	0.1
157	0.1
158	0.15
159	0.15
160	0.19
161	0.18
162	0.18
163	0.17
164	0.17
165	0.21
166	0.17
167	0.18
168	0.13
169	0.13
170	0.14
171	0.14
172	0.14
173	0.11
174	0.09
175	0.09
176	0.09
177	0.1
178	0.11
179	0.11
180	0.13
181	0.15
182	0.16
183	0.17
184	0.21
185	0.23
186	0.23
187	0.26
188	0.25
189	0.22
190	0.23
191	0.3
192	0.33
193	0.37
194	0.37
195	0.39
196	0.43
197	0.47
198	0.55
199	0.55
200	0.56
201	0.58
202	0.66
203	0.63
204	0.6
205	0.59
206	0.5
207	0.43
208	0.41
209	0.38
210	0.37
211	0.4
212	0.4
213	0.4
214	0.4
215	0.38
216	0.32
217	0.27
218	0.21
219	0.17
220	0.19
221	0.17
222	0.19
223	0.18
224	0.17
225	0.16
226	0.17
227	0.17
228	0.15
229	0.15
230	0.14
231	0.15
232	0.16
233	0.16
234	0.15
235	0.16
236	0.17
237	0.21
238	0.22
239	0.22
240	0.21
241	0.2
242	0.19
243	0.18
244	0.16
245	0.15
246	0.14
247	0.15
248	0.17
249	0.17
250	0.17
251	0.16
252	0.18
253	0.16
254	0.15
255	0.17
256	0.16
257	0.17
258	0.2
259	0.19
260	0.17
261	0.16
262	0.17
263	0.16
264	0.15
265	0.15
266	0.13
267	0.14
268	0.16
269	0.17
270	0.15
271	0.14
272	0.15
273	0.15
274	0.15
275	0.14
276	0.12
277	0.11
278	0.12
279	0.14
280	0.13
281	0.13
282	0.12
283	0.12
284	0.11
285	0.11
286	0.1
287	0.1
288	0.15
289	0.22
290	0.31
291	0.37
292	0.44
293	0.5
294	0.56
295	0.63
296	0.66
297	0.67
298	0.7
299	0.73
300	0.77
301	0.81
302	0.82
303	0.82
304	0.8
305	0.8
306	0.79
307	0.79
308	0.78
309	0.74
310	0.72
311	0.66
312	0.64
313	0.56
314	0.47
315	0.39
316	0.31
317	0.25
318	0.21
319	0.17
320	0.14
321	0.17
322	0.2
323	0.27
324	0.32
325	0.35
326	0.39
327	0.46
328	0.49
329	0.53
330	0.55
331	0.51
332	0.51
333	0.49
334	0.47
335	0.47
336	0.43
337	0.41
338	0.38
339	0.35
340	0.36
341	0.39
342	0.43
343	0.4
344	0.45
345	0.47
346	0.52
347	0.5
348	0.43
349	0.46
350	0.42
351	0.4
352	0.35
353	0.28
354	0.21
355	0.2
356	0.2
357	0.19
358	0.24
359	0.24
360	0.27
361	0.26
362	0.3
363	0.37
364	0.39
365	0.36
366	0.34
367	0.34
368	0.32
369	0.34
370	0.3
371	0.26
372	0.25
373	0.22
374	0.24
375	0.28
376	0.35
377	0.4
378	0.43
379	0.43
380	0.47
381	0.53
382	0.53
383	0.56
384	0.47
385	0.42
386	0.42
387	0.39
388	0.35
389	0.31
390	0.26
391	0.18
392	0.19
393	0.21
394	0.23
395	0.26
396	0.29
397	0.34
398	0.35
399	0.39
400	0.42
401	0.42
402	0.4
403	0.45
404	0.48
405	0.48
406	0.45
407	0.4
408	0.36
409	0.34
410	0.31
411	0.3
412	0.33
413	0.35
414	0.43
415	0.46
416	0.48
417	0.57
418	0.63
419	0.66

A0A5B1RD36

3D AlphaFold-predicted Structure Viewer