Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QWY2

Protein Details
Accession A0A5B1QWY2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-29HSPPCVPQKRRSKRVSTPPHAAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 4, extr 4
Family & Domain DBs
Amino Acid Sequences MAALFAHSPPCVPQKRRSKRVSTPPHAAVPHRTPPSPALACHAPLAPSRAAPTSAHVAVTRLNSAILWPVAPATCALAPSPHAPTTPLHALACPPHTPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.64
3 0.73
4 0.78
5 0.79
6 0.8
7 0.86
8 0.87
9 0.84
10 0.81
11 0.75
12 0.72
13 0.65
14 0.57
15 0.53
16 0.48
17 0.48
18 0.43
19 0.39
20 0.35
21 0.34
22 0.4
23 0.34
24 0.28
25 0.25
26 0.23
27 0.24
28 0.23
29 0.22
30 0.15
31 0.15
32 0.17
33 0.12
34 0.11
35 0.12
36 0.11
37 0.12
38 0.11
39 0.13
40 0.14
41 0.13
42 0.14
43 0.13
44 0.13
45 0.14
46 0.14
47 0.13
48 0.09
49 0.09
50 0.08
51 0.08
52 0.1
53 0.08
54 0.07
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.11
66 0.14
67 0.18
68 0.17
69 0.17
70 0.18
71 0.19
72 0.25
73 0.27
74 0.28
75 0.24
76 0.23
77 0.26
78 0.29
79 0.32