Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VU24

Protein Details
Accession H1VU24    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-32GLLRAMKWICRRKRLCKEESRLGLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.5, E.R. 3, cyto 2.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLGRTTNGLLRAMKWICRRKRLCKEESRLGLNLEIHVGVLRRLCLVFGGSRNAATTTTTTFXLLILLQLIPYAKIALFIVNLILYSNTYNX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.51
4 0.6
5 0.68
6 0.7
7 0.8
8 0.82
9 0.83
10 0.83
11 0.84
12 0.83
13 0.8
14 0.73
15 0.63
16 0.55
17 0.48
18 0.38
19 0.29
20 0.2
21 0.14
22 0.1
23 0.09
24 0.08
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.11
36 0.11
37 0.11
38 0.12
39 0.12
40 0.11
41 0.11
42 0.1
43 0.09
44 0.11
45 0.11
46 0.1
47 0.1
48 0.09
49 0.09
50 0.08
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.06
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07