Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RCE6

Protein Details
Accession A0A5B1RCE6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
218-247SCTSHSRRASRLRRRASRLRRRASCLRHRPHydrophilic
292-311APPSCASRLRRRASRICRAIHydrophilic
NLS Segment(s)
PositionSequence
224-239RRASRLRRRASRLRRR
Subcellular Location(s) mito 16, extr 5, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MPFRDPSATPFVARPHLVSRARALMPTFLRAHPCPFSGSRLAFLARSRLHAALPFPCARPSSRVRAPSCVRAFSRPPRHALIAPSHAHVPSCPLRASRPVSRPHHALVASRRVCAPTHPRTLVPVHLRAVALSRPSRPLRAVAPLLFHLVLVHVRPPPRPRALAPSCPSRRHPIVAFPPSAPLGRHARRAVAAFVPLVPLHISAGALAPSSCPYAPPSCTSHSRRASRLRRRASRLRRRASCLRHRPYAPPSCPYALPSCPYAPPSRPSPLRVAPTHRRRASRPAPSSCPYAPPSCASRLRRRASRICRAIAPVVPLPPRLAPTRRLRSCCAIACLGRFSCALVSPLRVSILRLMQLSRRCASRLVPRRLALSHACILVYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.39
4 0.41
5 0.4
6 0.4
7 0.42
8 0.42
9 0.41
10 0.38
11 0.36
12 0.34
13 0.38
14 0.36
15 0.32
16 0.37
17 0.36
18 0.4
19 0.36
20 0.35
21 0.35
22 0.33
23 0.36
24 0.37
25 0.36
26 0.33
27 0.32
28 0.33
29 0.29
30 0.29
31 0.32
32 0.26
33 0.29
34 0.3
35 0.28
36 0.28
37 0.29
38 0.31
39 0.26
40 0.31
41 0.3
42 0.28
43 0.29
44 0.3
45 0.3
46 0.33
47 0.35
48 0.38
49 0.43
50 0.5
51 0.51
52 0.58
53 0.61
54 0.64
55 0.62
56 0.59
57 0.54
58 0.52
59 0.57
60 0.58
61 0.64
62 0.58
63 0.59
64 0.57
65 0.59
66 0.55
67 0.52
68 0.48
69 0.45
70 0.42
71 0.39
72 0.36
73 0.32
74 0.29
75 0.25
76 0.24
77 0.22
78 0.23
79 0.23
80 0.23
81 0.26
82 0.33
83 0.39
84 0.41
85 0.43
86 0.5
87 0.54
88 0.58
89 0.59
90 0.53
91 0.52
92 0.45
93 0.43
94 0.4
95 0.45
96 0.41
97 0.38
98 0.37
99 0.33
100 0.32
101 0.33
102 0.35
103 0.33
104 0.39
105 0.4
106 0.39
107 0.41
108 0.43
109 0.44
110 0.4
111 0.36
112 0.29
113 0.3
114 0.29
115 0.26
116 0.26
117 0.2
118 0.2
119 0.18
120 0.19
121 0.23
122 0.25
123 0.27
124 0.26
125 0.27
126 0.24
127 0.28
128 0.29
129 0.24
130 0.24
131 0.23
132 0.23
133 0.21
134 0.18
135 0.12
136 0.1
137 0.09
138 0.08
139 0.09
140 0.1
141 0.12
142 0.16
143 0.2
144 0.25
145 0.29
146 0.31
147 0.3
148 0.38
149 0.42
150 0.47
151 0.47
152 0.51
153 0.52
154 0.53
155 0.53
156 0.5
157 0.47
158 0.42
159 0.39
160 0.37
161 0.4
162 0.41
163 0.4
164 0.34
165 0.33
166 0.3
167 0.3
168 0.22
169 0.17
170 0.21
171 0.21
172 0.27
173 0.26
174 0.26
175 0.27
176 0.28
177 0.26
178 0.18
179 0.17
180 0.11
181 0.11
182 0.1
183 0.09
184 0.08
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.04
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.06
198 0.06
199 0.06
200 0.08
201 0.11
202 0.12
203 0.15
204 0.18
205 0.21
206 0.29
207 0.34
208 0.41
209 0.46
210 0.49
211 0.53
212 0.6
213 0.67
214 0.7
215 0.75
216 0.76
217 0.76
218 0.8
219 0.84
220 0.85
221 0.85
222 0.85
223 0.85
224 0.81
225 0.8
226 0.81
227 0.8
228 0.8
229 0.8
230 0.76
231 0.73
232 0.69
233 0.68
234 0.68
235 0.68
236 0.6
237 0.52
238 0.49
239 0.45
240 0.42
241 0.39
242 0.34
243 0.26
244 0.25
245 0.24
246 0.22
247 0.21
248 0.24
249 0.25
250 0.24
251 0.26
252 0.29
253 0.34
254 0.35
255 0.37
256 0.42
257 0.44
258 0.47
259 0.48
260 0.51
261 0.54
262 0.61
263 0.68
264 0.67
265 0.66
266 0.64
267 0.7
268 0.71
269 0.71
270 0.7
271 0.67
272 0.68
273 0.66
274 0.68
275 0.58
276 0.54
277 0.47
278 0.41
279 0.36
280 0.32
281 0.33
282 0.34
283 0.41
284 0.43
285 0.51
286 0.57
287 0.64
288 0.68
289 0.72
290 0.76
291 0.77
292 0.81
293 0.77
294 0.71
295 0.67
296 0.63
297 0.59
298 0.51
299 0.46
300 0.37
301 0.35
302 0.33
303 0.3
304 0.28
305 0.26
306 0.27
307 0.28
308 0.29
309 0.33
310 0.42
311 0.52
312 0.58
313 0.61
314 0.64
315 0.65
316 0.68
317 0.64
318 0.58
319 0.53
320 0.47
321 0.44
322 0.45
323 0.38
324 0.32
325 0.28
326 0.24
327 0.2
328 0.19
329 0.19
330 0.15
331 0.18
332 0.18
333 0.19
334 0.2
335 0.19
336 0.19
337 0.22
338 0.25
339 0.25
340 0.25
341 0.26
342 0.3
343 0.36
344 0.4
345 0.38
346 0.37
347 0.35
348 0.37
349 0.41
350 0.46
351 0.5
352 0.54
353 0.59
354 0.58
355 0.61
356 0.6
357 0.59
358 0.53
359 0.49
360 0.43
361 0.36