Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QAW7

Protein Details
Accession A0A5B1QAW7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-101GVIATVKEKERKKRKASGGQDVEEHydrophilic
110-133SQIKHAAPAPKRRRKQNDGRNELLHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKERKKRKASGG
103-124ASKPGPSSQIKHAAPAPKRRRK
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 12, cyto_mito 7.333
Family & Domain DBs
Amino Acid Sequences MAADAQKLSLPAFLQLLTSNKLPMKRAMAVAGKIYKEFCTPERLGQLTDVKLTSLGVAEKEDRKLVLSAIAKAGYREGVIATVKEKERKKRKASGGQDVEEGASKPGPSSQIKHAAPAPKRRRKQNDGRNELLPDKPADEGATFGSLDFEELRDEQILKDKFVVVNRAPIMMAWSFVVAERLGFEREEALSIASVYTEMNAIAKGVSLGIYDEGKGKNLEAQPHGDQPYVDIMGRRIPLYQTAAGSWRALAASKPAPAGSAYSYITRSLRQTTPAVIGAMRLLAESYGTTEELNRVGWALYADFRPEVNEWGKKGEVRCEKILSLRRHQAVKADDNEATKSNQDGDFVTKAEGGEQDTGAAPRNAEALENPSERKISAANKDPDTIDEWFDDFTADDLEALP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.19
4 0.2
5 0.2
6 0.23
7 0.25
8 0.29
9 0.31
10 0.33
11 0.36
12 0.37
13 0.38
14 0.4
15 0.42
16 0.4
17 0.44
18 0.43
19 0.38
20 0.35
21 0.35
22 0.3
23 0.27
24 0.29
25 0.24
26 0.28
27 0.29
28 0.33
29 0.38
30 0.38
31 0.37
32 0.38
33 0.42
34 0.35
35 0.35
36 0.3
37 0.23
38 0.22
39 0.21
40 0.16
41 0.12
42 0.12
43 0.1
44 0.12
45 0.17
46 0.2
47 0.22
48 0.23
49 0.21
50 0.22
51 0.22
52 0.2
53 0.22
54 0.21
55 0.21
56 0.23
57 0.24
58 0.22
59 0.22
60 0.22
61 0.16
62 0.13
63 0.11
64 0.09
65 0.1
66 0.11
67 0.11
68 0.12
69 0.17
70 0.21
71 0.28
72 0.34
73 0.42
74 0.52
75 0.62
76 0.69
77 0.73
78 0.8
79 0.83
80 0.85
81 0.85
82 0.82
83 0.74
84 0.66
85 0.56
86 0.46
87 0.37
88 0.29
89 0.19
90 0.12
91 0.1
92 0.09
93 0.11
94 0.15
95 0.17
96 0.2
97 0.25
98 0.34
99 0.35
100 0.37
101 0.4
102 0.43
103 0.47
104 0.54
105 0.59
106 0.59
107 0.66
108 0.74
109 0.79
110 0.81
111 0.86
112 0.85
113 0.85
114 0.83
115 0.8
116 0.72
117 0.65
118 0.58
119 0.48
120 0.4
121 0.29
122 0.22
123 0.18
124 0.16
125 0.13
126 0.11
127 0.1
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.06
137 0.06
138 0.07
139 0.08
140 0.08
141 0.09
142 0.08
143 0.16
144 0.17
145 0.16
146 0.17
147 0.17
148 0.18
149 0.2
150 0.25
151 0.17
152 0.22
153 0.22
154 0.22
155 0.2
156 0.18
157 0.19
158 0.13
159 0.13
160 0.07
161 0.07
162 0.06
163 0.06
164 0.08
165 0.05
166 0.05
167 0.05
168 0.06
169 0.07
170 0.07
171 0.07
172 0.07
173 0.07
174 0.08
175 0.07
176 0.06
177 0.05
178 0.06
179 0.05
180 0.04
181 0.04
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.05
199 0.08
200 0.08
201 0.09
202 0.09
203 0.09
204 0.13
205 0.15
206 0.18
207 0.17
208 0.21
209 0.22
210 0.26
211 0.27
212 0.22
213 0.2
214 0.18
215 0.18
216 0.15
217 0.14
218 0.1
219 0.09
220 0.13
221 0.14
222 0.13
223 0.11
224 0.11
225 0.13
226 0.16
227 0.17
228 0.14
229 0.14
230 0.16
231 0.16
232 0.15
233 0.13
234 0.1
235 0.09
236 0.08
237 0.08
238 0.1
239 0.11
240 0.12
241 0.13
242 0.12
243 0.13
244 0.13
245 0.14
246 0.11
247 0.12
248 0.12
249 0.13
250 0.14
251 0.15
252 0.16
253 0.16
254 0.17
255 0.19
256 0.2
257 0.22
258 0.23
259 0.23
260 0.25
261 0.24
262 0.22
263 0.17
264 0.16
265 0.12
266 0.11
267 0.09
268 0.06
269 0.05
270 0.04
271 0.04
272 0.04
273 0.06
274 0.06
275 0.07
276 0.07
277 0.08
278 0.09
279 0.1
280 0.1
281 0.08
282 0.08
283 0.07
284 0.08
285 0.08
286 0.08
287 0.09
288 0.09
289 0.11
290 0.11
291 0.11
292 0.13
293 0.13
294 0.17
295 0.21
296 0.25
297 0.24
298 0.27
299 0.29
300 0.3
301 0.31
302 0.36
303 0.39
304 0.41
305 0.44
306 0.43
307 0.43
308 0.48
309 0.55
310 0.52
311 0.52
312 0.54
313 0.55
314 0.56
315 0.55
316 0.54
317 0.52
318 0.53
319 0.48
320 0.43
321 0.41
322 0.4
323 0.41
324 0.36
325 0.3
326 0.24
327 0.21
328 0.21
329 0.19
330 0.18
331 0.18
332 0.21
333 0.21
334 0.21
335 0.21
336 0.18
337 0.17
338 0.18
339 0.18
340 0.15
341 0.15
342 0.14
343 0.14
344 0.14
345 0.15
346 0.17
347 0.16
348 0.13
349 0.12
350 0.14
351 0.13
352 0.13
353 0.13
354 0.15
355 0.21
356 0.24
357 0.25
358 0.26
359 0.26
360 0.26
361 0.26
362 0.27
363 0.28
364 0.34
365 0.42
366 0.47
367 0.49
368 0.52
369 0.51
370 0.47
371 0.43
372 0.37
373 0.29
374 0.24
375 0.22
376 0.19
377 0.19
378 0.17
379 0.13
380 0.12
381 0.11
382 0.09