Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RED6

Protein Details
Accession A0A5B1RED6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
119-144KSLVCSRRHLAPRRRHTRRRTIVPPSHydrophilic
NLS Segment(s)
PositionSequence
126-170RHLAPRRRHTRRRTIVPPSPHRSPSQRHPYPRAAATRPAPPSRPS
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MPHPAVSHPTAPSRASAAPSHSAAVPSCSAAISRSHCCLAHHTVSLTALSRQPHRLGPSTRRLAAVPLAGASLGHLSPRAAIVCPRDGAPRPLPPHLCRSAAHMTGLRASAAPPSAQPKSLVCSRRHLAPRRRHTRRRTIVPPSPHRSPSQRHPYPRAAATRPAPPSRPSRWRHVPTDAACALATAPRALATVPRASPSCIPPHRLSPATHCHPAITRRSPAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.28
4 0.28
5 0.29
6 0.29
7 0.29
8 0.26
9 0.25
10 0.22
11 0.23
12 0.19
13 0.15
14 0.14
15 0.13
16 0.12
17 0.12
18 0.16
19 0.18
20 0.21
21 0.23
22 0.25
23 0.26
24 0.27
25 0.32
26 0.34
27 0.33
28 0.31
29 0.29
30 0.27
31 0.27
32 0.27
33 0.22
34 0.17
35 0.16
36 0.17
37 0.2
38 0.23
39 0.25
40 0.28
41 0.31
42 0.36
43 0.4
44 0.44
45 0.51
46 0.53
47 0.52
48 0.49
49 0.45
50 0.4
51 0.35
52 0.28
53 0.19
54 0.13
55 0.12
56 0.1
57 0.09
58 0.08
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.09
69 0.12
70 0.13
71 0.14
72 0.15
73 0.18
74 0.18
75 0.23
76 0.25
77 0.28
78 0.3
79 0.34
80 0.38
81 0.36
82 0.41
83 0.39
84 0.38
85 0.31
86 0.34
87 0.34
88 0.3
89 0.29
90 0.24
91 0.22
92 0.21
93 0.21
94 0.15
95 0.1
96 0.09
97 0.08
98 0.07
99 0.07
100 0.07
101 0.11
102 0.11
103 0.12
104 0.13
105 0.12
106 0.15
107 0.21
108 0.26
109 0.24
110 0.3
111 0.31
112 0.38
113 0.45
114 0.51
115 0.55
116 0.59
117 0.68
118 0.73
119 0.82
120 0.83
121 0.84
122 0.86
123 0.85
124 0.84
125 0.82
126 0.8
127 0.78
128 0.78
129 0.79
130 0.74
131 0.7
132 0.63
133 0.58
134 0.55
135 0.53
136 0.54
137 0.56
138 0.57
139 0.58
140 0.63
141 0.66
142 0.64
143 0.64
144 0.6
145 0.52
146 0.51
147 0.47
148 0.48
149 0.47
150 0.46
151 0.43
152 0.41
153 0.45
154 0.47
155 0.54
156 0.51
157 0.55
158 0.62
159 0.66
160 0.67
161 0.66
162 0.67
163 0.59
164 0.63
165 0.54
166 0.44
167 0.37
168 0.32
169 0.25
170 0.18
171 0.17
172 0.09
173 0.09
174 0.07
175 0.08
176 0.08
177 0.11
178 0.13
179 0.17
180 0.18
181 0.21
182 0.22
183 0.25
184 0.28
185 0.3
186 0.36
187 0.36
188 0.41
189 0.42
190 0.47
191 0.52
192 0.52
193 0.5
194 0.48
195 0.53
196 0.54
197 0.56
198 0.49
199 0.45
200 0.47
201 0.52
202 0.53
203 0.51
204 0.49