Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QEJ5

Protein Details
Accession A0A5B1QEJ5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
174-205SLSGNGRHKNKKDRSRKQDRRRWKTLRDFVDEBasic
NLS Segment(s)
PositionSequence
179-197GRHKNKKDRSRKQDRRRWK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007240  Atg17  
IPR045326  ATG17-like_dom  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0000422  P:autophagy of mitochondrion  
Pfam View protein in Pfam  
PF04108  ATG17_like  
Amino Acid Sequences MSASPPVQHSDQIDIVSLARHSEEALKRGEALCSRASTCTNASAQDAFDVLALNAKVKWISDSVVEQLKLAASVAKSIEEKRSKLDQQTQVGTHFLMWMTSTLTSIHQAWDKLRTQRTSALDAILESLGSQVVPPDFHDTLSDSSLFGSQPSDSEPEAPRKNASTLSQSQSAASLSGNGRHKNKKDRSRKQDRRRWKTLRDFVDERAIEEALETIDDDRAVLEDVLNTTADYPTTLHNTLTAIRDGLPRIDEQLSIERVLTDQERVSGTMAEQLESLAEHYDKMENACKEHEHGEAFVEEDLLEMNRDTEELPAIISELEESCAMIERNQDELLGAKRISQEKLQVLHTTLDDLEELGDIMGEMLEQQQSVEHSSIDHLTNLHQHLLTIEELEHRYTAYQASFHKLLIEIARRRQYKEAAENIVRGMMAQLEAMTEEERQVREDFNAEHGSHLPSDICLYIENPPTRWEVVPFDGDSIETLPDVDNDLLVQAKDAVAREEGHAPGTESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.17
5 0.13
6 0.11
7 0.11
8 0.11
9 0.19
10 0.23
11 0.25
12 0.29
13 0.28
14 0.3
15 0.31
16 0.35
17 0.29
18 0.28
19 0.28
20 0.28
21 0.29
22 0.29
23 0.3
24 0.29
25 0.28
26 0.3
27 0.27
28 0.26
29 0.27
30 0.25
31 0.24
32 0.21
33 0.19
34 0.14
35 0.12
36 0.12
37 0.09
38 0.12
39 0.11
40 0.12
41 0.11
42 0.12
43 0.12
44 0.12
45 0.14
46 0.11
47 0.13
48 0.14
49 0.16
50 0.2
51 0.25
52 0.25
53 0.22
54 0.22
55 0.21
56 0.18
57 0.16
58 0.15
59 0.09
60 0.12
61 0.12
62 0.14
63 0.16
64 0.18
65 0.28
66 0.31
67 0.32
68 0.35
69 0.43
70 0.45
71 0.51
72 0.59
73 0.57
74 0.58
75 0.62
76 0.58
77 0.52
78 0.47
79 0.39
80 0.3
81 0.23
82 0.16
83 0.11
84 0.09
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.1
91 0.12
92 0.12
93 0.15
94 0.16
95 0.18
96 0.19
97 0.25
98 0.3
99 0.35
100 0.41
101 0.41
102 0.41
103 0.47
104 0.48
105 0.46
106 0.42
107 0.36
108 0.29
109 0.27
110 0.25
111 0.17
112 0.13
113 0.08
114 0.07
115 0.06
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.08
122 0.14
123 0.14
124 0.15
125 0.16
126 0.17
127 0.18
128 0.19
129 0.18
130 0.12
131 0.12
132 0.13
133 0.12
134 0.1
135 0.09
136 0.07
137 0.08
138 0.1
139 0.12
140 0.11
141 0.15
142 0.18
143 0.25
144 0.28
145 0.29
146 0.29
147 0.28
148 0.3
149 0.29
150 0.28
151 0.27
152 0.3
153 0.32
154 0.34
155 0.32
156 0.3
157 0.28
158 0.26
159 0.19
160 0.13
161 0.13
162 0.1
163 0.16
164 0.21
165 0.25
166 0.31
167 0.38
168 0.45
169 0.52
170 0.61
171 0.65
172 0.72
173 0.79
174 0.83
175 0.87
176 0.92
177 0.92
178 0.93
179 0.93
180 0.92
181 0.91
182 0.89
183 0.87
184 0.87
185 0.85
186 0.81
187 0.77
188 0.7
189 0.61
190 0.62
191 0.52
192 0.41
193 0.34
194 0.27
195 0.19
196 0.17
197 0.15
198 0.06
199 0.06
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.05
208 0.05
209 0.04
210 0.04
211 0.05
212 0.06
213 0.06
214 0.05
215 0.05
216 0.06
217 0.05
218 0.05
219 0.06
220 0.07
221 0.1
222 0.11
223 0.1
224 0.11
225 0.12
226 0.13
227 0.14
228 0.13
229 0.1
230 0.1
231 0.12
232 0.12
233 0.12
234 0.1
235 0.09
236 0.11
237 0.11
238 0.1
239 0.1
240 0.14
241 0.14
242 0.13
243 0.13
244 0.11
245 0.1
246 0.11
247 0.1
248 0.08
249 0.07
250 0.08
251 0.09
252 0.09
253 0.09
254 0.08
255 0.08
256 0.12
257 0.12
258 0.1
259 0.1
260 0.09
261 0.09
262 0.08
263 0.09
264 0.05
265 0.05
266 0.04
267 0.05
268 0.07
269 0.07
270 0.09
271 0.14
272 0.14
273 0.15
274 0.16
275 0.16
276 0.17
277 0.19
278 0.19
279 0.14
280 0.14
281 0.13
282 0.12
283 0.12
284 0.1
285 0.08
286 0.06
287 0.05
288 0.05
289 0.04
290 0.05
291 0.04
292 0.04
293 0.04
294 0.05
295 0.05
296 0.05
297 0.06
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.04
304 0.05
305 0.04
306 0.05
307 0.05
308 0.05
309 0.05
310 0.07
311 0.07
312 0.07
313 0.1
314 0.1
315 0.12
316 0.12
317 0.12
318 0.11
319 0.13
320 0.14
321 0.14
322 0.13
323 0.13
324 0.17
325 0.2
326 0.22
327 0.21
328 0.25
329 0.27
330 0.3
331 0.3
332 0.28
333 0.27
334 0.26
335 0.24
336 0.2
337 0.16
338 0.13
339 0.11
340 0.09
341 0.07
342 0.06
343 0.06
344 0.04
345 0.04
346 0.03
347 0.03
348 0.03
349 0.02
350 0.03
351 0.04
352 0.04
353 0.04
354 0.04
355 0.05
356 0.06
357 0.09
358 0.09
359 0.08
360 0.09
361 0.1
362 0.13
363 0.13
364 0.13
365 0.11
366 0.12
367 0.17
368 0.18
369 0.19
370 0.16
371 0.15
372 0.15
373 0.17
374 0.15
375 0.11
376 0.1
377 0.12
378 0.13
379 0.14
380 0.13
381 0.11
382 0.12
383 0.12
384 0.13
385 0.11
386 0.14
387 0.15
388 0.21
389 0.22
390 0.21
391 0.22
392 0.2
393 0.21
394 0.23
395 0.3
396 0.29
397 0.37
398 0.45
399 0.47
400 0.49
401 0.52
402 0.53
403 0.53
404 0.56
405 0.55
406 0.55
407 0.55
408 0.52
409 0.47
410 0.42
411 0.33
412 0.24
413 0.17
414 0.1
415 0.08
416 0.07
417 0.06
418 0.05
419 0.06
420 0.07
421 0.08
422 0.07
423 0.09
424 0.12
425 0.13
426 0.15
427 0.16
428 0.17
429 0.17
430 0.21
431 0.2
432 0.22
433 0.27
434 0.24
435 0.25
436 0.26
437 0.26
438 0.23
439 0.23
440 0.18
441 0.13
442 0.14
443 0.13
444 0.12
445 0.1
446 0.11
447 0.17
448 0.24
449 0.26
450 0.25
451 0.27
452 0.3
453 0.32
454 0.32
455 0.29
456 0.26
457 0.28
458 0.31
459 0.3
460 0.27
461 0.25
462 0.24
463 0.22
464 0.17
465 0.14
466 0.1
467 0.1
468 0.09
469 0.09
470 0.12
471 0.11
472 0.1
473 0.09
474 0.1
475 0.12
476 0.11
477 0.11
478 0.09
479 0.1
480 0.12
481 0.13
482 0.14
483 0.14
484 0.16
485 0.18
486 0.22
487 0.22
488 0.21
489 0.21