Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SS17

Protein Details
Accession Q8SS17   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-22VPTANKYKIKRRLLEKKALLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005326  S10_plectin_N  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0005840  C:ribosome  
KEGG ecu:ECU04_1355  -  
Pfam View protein in Pfam  
PF03501  S10_plectin  
Amino Acid Sequences MLVPTANKYKIKRRLLEKKALLLEDTVLGNHRDLEIPNLHLKIFMKTMISYGYVQRIHVWRHSYFLLTPLGESRLREELVFTDEGVASQEAPAVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.83
4 0.77
5 0.75
6 0.7
7 0.63
8 0.53
9 0.42
10 0.34
11 0.26
12 0.21
13 0.13
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.12
22 0.12
23 0.14
24 0.17
25 0.17
26 0.16
27 0.17
28 0.17
29 0.15
30 0.14
31 0.13
32 0.11
33 0.1
34 0.11
35 0.1
36 0.11
37 0.1
38 0.1
39 0.15
40 0.14
41 0.14
42 0.17
43 0.19
44 0.2
45 0.23
46 0.27
47 0.22
48 0.24
49 0.25
50 0.23
51 0.2
52 0.21
53 0.19
54 0.15
55 0.15
56 0.14
57 0.16
58 0.16
59 0.16
60 0.17
61 0.18
62 0.19
63 0.18
64 0.18
65 0.16
66 0.19
67 0.19
68 0.16
69 0.14
70 0.13
71 0.13
72 0.14
73 0.13
74 0.09
75 0.09
76 0.11