Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1W3U8

Protein Details
Accession H1W3U8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-71STPQAESRNLSRRRRCRRRRYPGPAATAPSHydrophilic
NLS Segment(s)
PositionSequence
53-61RRRRCRRRR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSSNQLRRTARPETTRRVIATASRRPLEKPSYAESRCPQRSSTPQAESRNLSRRRRCRRRRYPGPAATAPSVRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.58
4 0.53
5 0.46
6 0.43
7 0.45
8 0.44
9 0.43
10 0.4
11 0.4
12 0.39
13 0.44
14 0.42
15 0.37
16 0.33
17 0.32
18 0.39
19 0.39
20 0.42
21 0.4
22 0.44
23 0.44
24 0.41
25 0.37
26 0.34
27 0.39
28 0.43
29 0.46
30 0.42
31 0.46
32 0.49
33 0.51
34 0.49
35 0.5
36 0.52
37 0.54
38 0.58
39 0.6
40 0.67
41 0.75
42 0.83
43 0.87
44 0.89
45 0.92
46 0.94
47 0.95
48 0.95
49 0.94
50 0.91
51 0.89
52 0.83
53 0.77
54 0.69