Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RD43

Protein Details
Accession A0A5B1RD43    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-46AGSFSPPRPRSRSRRPARPYVASYAFSLPRTPRNRPPCRPRALPHydrophilic
NLS Segment(s)
PositionSequence
10-18RPRSRSRRP
83-87RPSRR
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MPAGSFSPPRPRSRSRRPARPYVASYAFSLPRTPRNRPPCRPRALPALATVLDARSTPFRYPVRRRVALHAHAPPSPSNRPVRPSRRRVPASPPTPSRCPSRSCAVQSPQPLSHILARPLSQPQASLQHRERHETSRTTSTPPCRISRSPALHVITLRVVSPPPVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.84
4 0.84
5 0.87
6 0.86
7 0.85
8 0.78
9 0.75
10 0.69
11 0.6
12 0.54
13 0.48
14 0.42
15 0.35
16 0.34
17 0.28
18 0.33
19 0.37
20 0.42
21 0.47
22 0.55
23 0.65
24 0.71
25 0.79
26 0.79
27 0.81
28 0.8
29 0.74
30 0.72
31 0.67
32 0.59
33 0.5
34 0.44
35 0.36
36 0.32
37 0.28
38 0.18
39 0.14
40 0.12
41 0.11
42 0.1
43 0.12
44 0.12
45 0.19
46 0.23
47 0.32
48 0.4
49 0.48
50 0.54
51 0.57
52 0.59
53 0.59
54 0.63
55 0.58
56 0.56
57 0.51
58 0.44
59 0.39
60 0.38
61 0.33
62 0.3
63 0.28
64 0.27
65 0.27
66 0.27
67 0.31
68 0.39
69 0.48
70 0.52
71 0.59
72 0.62
73 0.67
74 0.69
75 0.67
76 0.67
77 0.66
78 0.62
79 0.6
80 0.58
81 0.54
82 0.53
83 0.53
84 0.5
85 0.43
86 0.42
87 0.39
88 0.4
89 0.4
90 0.41
91 0.46
92 0.44
93 0.46
94 0.46
95 0.47
96 0.41
97 0.36
98 0.32
99 0.27
100 0.29
101 0.27
102 0.25
103 0.23
104 0.23
105 0.23
106 0.25
107 0.26
108 0.2
109 0.18
110 0.18
111 0.26
112 0.27
113 0.33
114 0.35
115 0.41
116 0.42
117 0.48
118 0.49
119 0.45
120 0.49
121 0.46
122 0.46
123 0.47
124 0.47
125 0.46
126 0.5
127 0.52
128 0.54
129 0.55
130 0.54
131 0.52
132 0.53
133 0.56
134 0.59
135 0.58
136 0.55
137 0.58
138 0.56
139 0.52
140 0.5
141 0.45
142 0.37
143 0.31
144 0.26
145 0.2
146 0.17