Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RB23

Protein Details
Accession A0A5B1RB23    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
104-124SVPYTQSTRHTRRRRAAHAVLHydrophilic
398-418APTRRTPPPLAARPLRRRFHAHydrophilic
NLS Segment(s)
PositionSequence
216-220RAARR
Subcellular Location(s) nucl 10, mito 6, extr 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSHPPLLSFAFATTPCSLAAVTRPCVPLHPTAVVCIHDDAPLPRPALTHPHAPPSPPSSLFAFATTCSLALPSPALAPSTSSIAPFAASARHTRPLRAIHALSVPYTQSTRHTRRRRAAHAVLAASTASSHPVPPNPRSQRTLLEPSALPYTLSTRRPRRTFDELSAPFTPPSRALNTLDATSLRPPPPSTRPQHAVRGVNVPSPPSPPPPRALRAARRPPPPSAPSTALCGPFCGPFCHPSPSAIIRRPFCRPSAPSTAVLARPPPPPPCPTAALVCPQPPSPPSLVQPPPFTPCRRLRPLRALSALRRPSQSSSAPPRCLPPSRTVFAPAVVFGPPSPSLPPLHRLRLRRAVFTPAVFFSRPSAAPSAPCCPFFGPQGPISHPPDPCCRCTPPFAPTRRTPPPLAARPLRRRFHAPCAVALSCPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.17
4 0.17
5 0.16
6 0.13
7 0.21
8 0.22
9 0.24
10 0.28
11 0.3
12 0.3
13 0.33
14 0.35
15 0.33
16 0.32
17 0.35
18 0.3
19 0.31
20 0.34
21 0.32
22 0.3
23 0.27
24 0.23
25 0.19
26 0.21
27 0.19
28 0.21
29 0.24
30 0.23
31 0.21
32 0.21
33 0.22
34 0.29
35 0.3
36 0.35
37 0.33
38 0.41
39 0.42
40 0.43
41 0.46
42 0.42
43 0.44
44 0.37
45 0.37
46 0.31
47 0.33
48 0.32
49 0.28
50 0.24
51 0.19
52 0.2
53 0.17
54 0.14
55 0.11
56 0.11
57 0.09
58 0.09
59 0.09
60 0.07
61 0.08
62 0.09
63 0.1
64 0.09
65 0.11
66 0.11
67 0.14
68 0.14
69 0.13
70 0.13
71 0.12
72 0.12
73 0.11
74 0.11
75 0.1
76 0.11
77 0.15
78 0.18
79 0.27
80 0.27
81 0.29
82 0.34
83 0.37
84 0.41
85 0.43
86 0.4
87 0.34
88 0.37
89 0.36
90 0.31
91 0.27
92 0.22
93 0.17
94 0.17
95 0.15
96 0.17
97 0.26
98 0.35
99 0.44
100 0.54
101 0.62
102 0.7
103 0.79
104 0.81
105 0.81
106 0.77
107 0.74
108 0.69
109 0.6
110 0.51
111 0.42
112 0.34
113 0.24
114 0.18
115 0.11
116 0.08
117 0.07
118 0.08
119 0.1
120 0.15
121 0.21
122 0.24
123 0.34
124 0.4
125 0.45
126 0.47
127 0.48
128 0.47
129 0.49
130 0.53
131 0.44
132 0.39
133 0.34
134 0.32
135 0.31
136 0.27
137 0.2
138 0.13
139 0.17
140 0.19
141 0.25
142 0.31
143 0.38
144 0.47
145 0.51
146 0.55
147 0.58
148 0.61
149 0.6
150 0.55
151 0.57
152 0.49
153 0.51
154 0.48
155 0.42
156 0.33
157 0.29
158 0.26
159 0.17
160 0.18
161 0.15
162 0.17
163 0.18
164 0.21
165 0.22
166 0.21
167 0.2
168 0.18
169 0.17
170 0.16
171 0.18
172 0.16
173 0.16
174 0.17
175 0.21
176 0.27
177 0.34
178 0.36
179 0.39
180 0.44
181 0.47
182 0.53
183 0.54
184 0.5
185 0.44
186 0.44
187 0.39
188 0.36
189 0.32
190 0.26
191 0.21
192 0.21
193 0.2
194 0.21
195 0.24
196 0.22
197 0.27
198 0.3
199 0.32
200 0.36
201 0.41
202 0.43
203 0.49
204 0.58
205 0.6
206 0.63
207 0.63
208 0.59
209 0.59
210 0.54
211 0.47
212 0.41
213 0.38
214 0.31
215 0.33
216 0.33
217 0.28
218 0.25
219 0.23
220 0.19
221 0.18
222 0.18
223 0.16
224 0.14
225 0.15
226 0.17
227 0.21
228 0.2
229 0.19
230 0.22
231 0.26
232 0.31
233 0.33
234 0.37
235 0.35
236 0.38
237 0.42
238 0.4
239 0.37
240 0.37
241 0.34
242 0.35
243 0.41
244 0.41
245 0.37
246 0.37
247 0.38
248 0.33
249 0.31
250 0.27
251 0.21
252 0.21
253 0.23
254 0.24
255 0.24
256 0.26
257 0.28
258 0.29
259 0.29
260 0.28
261 0.28
262 0.26
263 0.27
264 0.26
265 0.26
266 0.23
267 0.21
268 0.2
269 0.18
270 0.2
271 0.19
272 0.19
273 0.2
274 0.27
275 0.32
276 0.33
277 0.37
278 0.35
279 0.37
280 0.4
281 0.4
282 0.4
283 0.43
284 0.49
285 0.55
286 0.59
287 0.62
288 0.68
289 0.72
290 0.7
291 0.68
292 0.65
293 0.6
294 0.63
295 0.61
296 0.53
297 0.5
298 0.45
299 0.42
300 0.42
301 0.4
302 0.39
303 0.44
304 0.49
305 0.5
306 0.49
307 0.5
308 0.5
309 0.53
310 0.48
311 0.46
312 0.45
313 0.44
314 0.44
315 0.44
316 0.39
317 0.34
318 0.32
319 0.24
320 0.18
321 0.16
322 0.15
323 0.1
324 0.13
325 0.12
326 0.12
327 0.13
328 0.14
329 0.17
330 0.19
331 0.27
332 0.3
333 0.39
334 0.44
335 0.47
336 0.54
337 0.62
338 0.62
339 0.6
340 0.56
341 0.55
342 0.52
343 0.49
344 0.43
345 0.35
346 0.36
347 0.3
348 0.28
349 0.23
350 0.24
351 0.23
352 0.23
353 0.24
354 0.22
355 0.25
356 0.29
357 0.33
358 0.31
359 0.31
360 0.31
361 0.29
362 0.3
363 0.31
364 0.33
365 0.3
366 0.32
367 0.36
368 0.38
369 0.42
370 0.46
371 0.47
372 0.44
373 0.44
374 0.5
375 0.5
376 0.51
377 0.5
378 0.51
379 0.49
380 0.54
381 0.55
382 0.53
383 0.57
384 0.6
385 0.62
386 0.63
387 0.68
388 0.7
389 0.7
390 0.65
391 0.65
392 0.68
393 0.68
394 0.71
395 0.71
396 0.72
397 0.78
398 0.85
399 0.81
400 0.76
401 0.77
402 0.74
403 0.75
404 0.74
405 0.65
406 0.61
407 0.62
408 0.57