Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R9T2

Protein Details
Accession A0A5B1R9T2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-128GPPPAPRRKRTSKAPKSRRRSASPBasic
153-175ATLSKERKERERRSEEQKHKRESBasic
NLS Segment(s)
PositionSequence
104-131GGPPPAPRRKRTSKAPKSRRRSASPLRR
159-166RKERERRS
Subcellular Location(s) cyto 7, mito 5, nucl 4, E.R. 4, cyto_pero 4, vacu 3
Family & Domain DBs
Amino Acid Sequences MEVNRAGVLGLFLILGIWVRRRLYPLPGLLLHRAFVPELRGRVQIKRVLFSCRCAPEASCPFRPPLCPPIVKPRCQGAKFAETRSGIEPMATLSPGTGGKHLSGGPPPAPRRKRTSKAPKSRRRSASPLRRDPIPSIEEQLEAKYRKDEEFWATLSKERKERERRSEEQKHKRESVEGDAWEQGTGDPLKVDEERRQEFVDIKERYERLRKSADEHFQLVKDTAQRINAFDEGLRDVRRAVRRIEDERRHTRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.09
5 0.13
6 0.15
7 0.17
8 0.22
9 0.25
10 0.3
11 0.35
12 0.36
13 0.37
14 0.39
15 0.42
16 0.42
17 0.39
18 0.33
19 0.27
20 0.25
21 0.2
22 0.18
23 0.2
24 0.19
25 0.21
26 0.23
27 0.28
28 0.3
29 0.34
30 0.39
31 0.4
32 0.37
33 0.4
34 0.4
35 0.43
36 0.42
37 0.42
38 0.43
39 0.41
40 0.4
41 0.36
42 0.35
43 0.36
44 0.44
45 0.45
46 0.42
47 0.4
48 0.42
49 0.42
50 0.43
51 0.39
52 0.37
53 0.37
54 0.35
55 0.37
56 0.46
57 0.51
58 0.52
59 0.51
60 0.52
61 0.54
62 0.52
63 0.54
64 0.48
65 0.51
66 0.5
67 0.48
68 0.46
69 0.37
70 0.38
71 0.36
72 0.32
73 0.22
74 0.19
75 0.17
76 0.12
77 0.12
78 0.1
79 0.07
80 0.05
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.1
89 0.1
90 0.11
91 0.13
92 0.14
93 0.2
94 0.24
95 0.32
96 0.37
97 0.4
98 0.46
99 0.54
100 0.57
101 0.62
102 0.7
103 0.71
104 0.78
105 0.85
106 0.87
107 0.86
108 0.89
109 0.85
110 0.8
111 0.78
112 0.77
113 0.76
114 0.76
115 0.76
116 0.68
117 0.64
118 0.59
119 0.52
120 0.46
121 0.38
122 0.28
123 0.22
124 0.21
125 0.19
126 0.18
127 0.17
128 0.18
129 0.17
130 0.16
131 0.16
132 0.17
133 0.17
134 0.18
135 0.2
136 0.18
137 0.2
138 0.2
139 0.21
140 0.2
141 0.23
142 0.26
143 0.27
144 0.29
145 0.29
146 0.38
147 0.46
148 0.55
149 0.61
150 0.65
151 0.68
152 0.73
153 0.81
154 0.82
155 0.82
156 0.82
157 0.78
158 0.74
159 0.69
160 0.62
161 0.55
162 0.51
163 0.46
164 0.38
165 0.33
166 0.3
167 0.29
168 0.25
169 0.21
170 0.14
171 0.11
172 0.11
173 0.09
174 0.08
175 0.08
176 0.11
177 0.12
178 0.16
179 0.18
180 0.26
181 0.29
182 0.31
183 0.32
184 0.31
185 0.33
186 0.36
187 0.39
188 0.33
189 0.32
190 0.36
191 0.36
192 0.4
193 0.46
194 0.43
195 0.4
196 0.46
197 0.45
198 0.44
199 0.52
200 0.55
201 0.5
202 0.52
203 0.48
204 0.42
205 0.42
206 0.38
207 0.31
208 0.27
209 0.26
210 0.25
211 0.27
212 0.28
213 0.27
214 0.3
215 0.28
216 0.25
217 0.22
218 0.22
219 0.2
220 0.23
221 0.23
222 0.19
223 0.21
224 0.28
225 0.35
226 0.36
227 0.37
228 0.42
229 0.49
230 0.57
231 0.66
232 0.68
233 0.7