Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VNP8

Protein Details
Accession H1VNP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-36AYLPRKRAARHRGKVKSFPKDDBasic
NLS Segment(s)
PositionSequence
18-37PRKRAARHRGKVKSFPKDDA
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences MRIHTKLLGTRGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTAAMGYKAGMTTIVRDLDRPGAKANKKEVVEAVSIIDTPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.33
4 0.36
5 0.38
6 0.41
7 0.43
8 0.52
9 0.59
10 0.6
11 0.65
12 0.71
13 0.75
14 0.77
15 0.83
16 0.82
17 0.81
18 0.73
19 0.7
20 0.69
21 0.66
22 0.64
23 0.64
24 0.59
25 0.53
26 0.52
27 0.49
28 0.4
29 0.33
30 0.29
31 0.23
32 0.23
33 0.18
34 0.16
35 0.13
36 0.12
37 0.11
38 0.1
39 0.08
40 0.04
41 0.06
42 0.08
43 0.11
44 0.11
45 0.12
46 0.13
47 0.2
48 0.22
49 0.21
50 0.24
51 0.31
52 0.36
53 0.42
54 0.46
55 0.46
56 0.46
57 0.47
58 0.44
59 0.38
60 0.35
61 0.3
62 0.25
63 0.18