Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QJ22

Protein Details
Accession A0A5B1QJ22    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-130DGPGGKKEKVRLRKENRQRIRDQNFMKBasic
NLS Segment(s)
PositionSequence
108-120GKKEKVRLRKENR
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFLRALSRPSLALRRPAAPLASTSRNYAASKAKGAAPGESAPQATIDAVVPEIPEGSHSTCAPNTVLAGLNYRKDQPPVLALPDEEYPPWLWKLLDPPALVEDGPGGKKEKVRLRKENRQRIRDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.39
4 0.4
5 0.37
6 0.29
7 0.3
8 0.28
9 0.31
10 0.29
11 0.29
12 0.29
13 0.31
14 0.31
15 0.31
16 0.32
17 0.29
18 0.3
19 0.29
20 0.29
21 0.29
22 0.29
23 0.26
24 0.22
25 0.2
26 0.19
27 0.18
28 0.16
29 0.12
30 0.12
31 0.11
32 0.08
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.07
45 0.09
46 0.09
47 0.11
48 0.1
49 0.12
50 0.11
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.1
57 0.11
58 0.12
59 0.13
60 0.15
61 0.15
62 0.15
63 0.15
64 0.13
65 0.16
66 0.16
67 0.17
68 0.16
69 0.15
70 0.15
71 0.16
72 0.15
73 0.12
74 0.12
75 0.11
76 0.12
77 0.12
78 0.11
79 0.11
80 0.11
81 0.17
82 0.21
83 0.25
84 0.23
85 0.23
86 0.23
87 0.24
88 0.22
89 0.17
90 0.13
91 0.11
92 0.12
93 0.13
94 0.15
95 0.16
96 0.2
97 0.28
98 0.36
99 0.44
100 0.53
101 0.62
102 0.69
103 0.78
104 0.86
105 0.9
106 0.9
107 0.89
108 0.88
109 0.88
110 0.85
111 0.84
112 0.79