Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W3K1

Protein Details
Accession H1W3K1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
136-165TPFTVRPLYPLRKKQKRRKEYTPGPPNPGLHydrophilic
NLS Segment(s)
PositionSequence
147-154RKKQKRRK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.833, mito 7.5, cyto_mito 7.333, cyto 6
Family & Domain DBs
Amino Acid Sequences MDGRKRPEGFNESYVSDGMYVYNVTSLVRYNKLDPWLDVLKLKAGSVLSADVPEEYKVKKWLWNTNRHRIIGLYRSPKHSLSSAEIPFAWKTSPRRMPSMTPKLVPGSDPSEDATKKTWAQVVLHPPMGVPAPPTTPFTVRPLYPLRKKQKRRKEYTPGPPNPGLSLPRPFGSVPGSPMDVSQSIAMTALEEMGGRDVSWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.28
3 0.21
4 0.16
5 0.11
6 0.09
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.11
14 0.14
15 0.18
16 0.2
17 0.22
18 0.27
19 0.32
20 0.33
21 0.3
22 0.32
23 0.31
24 0.3
25 0.29
26 0.25
27 0.24
28 0.23
29 0.22
30 0.18
31 0.15
32 0.13
33 0.13
34 0.13
35 0.09
36 0.09
37 0.1
38 0.08
39 0.09
40 0.09
41 0.1
42 0.1
43 0.12
44 0.16
45 0.18
46 0.22
47 0.26
48 0.36
49 0.42
50 0.52
51 0.58
52 0.65
53 0.7
54 0.66
55 0.61
56 0.52
57 0.48
58 0.44
59 0.43
60 0.41
61 0.37
62 0.41
63 0.43
64 0.42
65 0.39
66 0.34
67 0.3
68 0.26
69 0.3
70 0.26
71 0.25
72 0.24
73 0.24
74 0.22
75 0.2
76 0.15
77 0.12
78 0.16
79 0.23
80 0.31
81 0.32
82 0.36
83 0.38
84 0.43
85 0.49
86 0.55
87 0.48
88 0.41
89 0.4
90 0.37
91 0.35
92 0.3
93 0.22
94 0.16
95 0.15
96 0.15
97 0.14
98 0.17
99 0.17
100 0.17
101 0.17
102 0.16
103 0.16
104 0.17
105 0.18
106 0.16
107 0.18
108 0.22
109 0.27
110 0.28
111 0.28
112 0.26
113 0.23
114 0.23
115 0.21
116 0.16
117 0.1
118 0.08
119 0.1
120 0.12
121 0.14
122 0.15
123 0.17
124 0.19
125 0.22
126 0.24
127 0.22
128 0.25
129 0.31
130 0.38
131 0.45
132 0.53
133 0.6
134 0.68
135 0.78
136 0.84
137 0.87
138 0.89
139 0.9
140 0.9
141 0.91
142 0.9
143 0.91
144 0.91
145 0.86
146 0.82
147 0.76
148 0.66
149 0.57
150 0.5
151 0.42
152 0.35
153 0.34
154 0.29
155 0.27
156 0.29
157 0.27
158 0.25
159 0.26
160 0.24
161 0.21
162 0.21
163 0.23
164 0.2
165 0.21
166 0.22
167 0.18
168 0.17
169 0.15
170 0.13
171 0.11
172 0.11
173 0.11
174 0.08
175 0.08
176 0.06
177 0.06
178 0.06
179 0.06
180 0.07
181 0.08