Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R5B0

Protein Details
Accession A0A5B1R5B0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
300-324AAQPQRRHMMRRSRRSLKSRMAALDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 10
Family & Domain DBs
Amino Acid Sequences MRTSTVFVASTLLASATLSFAAPIVSEGGAALLERDPKFKLPHVSSGTAGSAAQGADVGLQLGQLFNLTRRDVEALSEREPKFKLPSGVAGDAAHGGELGLQVGQLFNLTRRGLELLSEREPAFKIPKIPAGVASDGARGAELGLNVGQLFNLSLRDVELSERDPKFSLPKISPETATGAAQGAELGLELGQLFNLTRRGLELLERDPKARLSAGTAGAAAHGADLGLDLGQLFNLTLRSIELLEREPKFKLPKIPSGTAGAAAHGAGLGLDIGQLFGFGDNSATDSTDATTAAGADTVAAQPQRRHMMRRSRRSLKSRMAALDVNELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.13
21 0.14
22 0.17
23 0.19
24 0.23
25 0.27
26 0.32
27 0.39
28 0.37
29 0.46
30 0.5
31 0.5
32 0.47
33 0.45
34 0.41
35 0.32
36 0.27
37 0.18
38 0.13
39 0.1
40 0.09
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.08
54 0.12
55 0.12
56 0.13
57 0.14
58 0.17
59 0.16
60 0.19
61 0.23
62 0.23
63 0.27
64 0.35
65 0.34
66 0.36
67 0.36
68 0.36
69 0.33
70 0.34
71 0.33
72 0.26
73 0.32
74 0.34
75 0.34
76 0.33
77 0.27
78 0.24
79 0.21
80 0.19
81 0.12
82 0.07
83 0.05
84 0.05
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.1
96 0.1
97 0.1
98 0.11
99 0.13
100 0.12
101 0.14
102 0.16
103 0.16
104 0.18
105 0.21
106 0.2
107 0.2
108 0.2
109 0.2
110 0.2
111 0.18
112 0.19
113 0.18
114 0.23
115 0.23
116 0.23
117 0.24
118 0.23
119 0.22
120 0.19
121 0.18
122 0.14
123 0.12
124 0.12
125 0.09
126 0.06
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.03
137 0.04
138 0.03
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.07
147 0.08
148 0.15
149 0.15
150 0.16
151 0.16
152 0.16
153 0.19
154 0.2
155 0.23
156 0.18
157 0.23
158 0.27
159 0.28
160 0.28
161 0.25
162 0.26
163 0.22
164 0.21
165 0.15
166 0.11
167 0.1
168 0.09
169 0.08
170 0.05
171 0.03
172 0.03
173 0.03
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.03
180 0.03
181 0.04
182 0.06
183 0.06
184 0.06
185 0.08
186 0.09
187 0.09
188 0.12
189 0.14
190 0.17
191 0.24
192 0.25
193 0.25
194 0.24
195 0.25
196 0.23
197 0.21
198 0.17
199 0.13
200 0.16
201 0.17
202 0.16
203 0.16
204 0.14
205 0.13
206 0.13
207 0.09
208 0.05
209 0.03
210 0.03
211 0.02
212 0.03
213 0.03
214 0.02
215 0.02
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.04
223 0.04
224 0.05
225 0.05
226 0.06
227 0.07
228 0.08
229 0.09
230 0.12
231 0.19
232 0.21
233 0.22
234 0.22
235 0.27
236 0.32
237 0.34
238 0.4
239 0.4
240 0.48
241 0.53
242 0.55
243 0.52
244 0.51
245 0.47
246 0.41
247 0.35
248 0.26
249 0.19
250 0.15
251 0.13
252 0.08
253 0.07
254 0.04
255 0.03
256 0.03
257 0.02
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.04
264 0.04
265 0.05
266 0.04
267 0.05
268 0.05
269 0.07
270 0.08
271 0.08
272 0.09
273 0.09
274 0.1
275 0.1
276 0.1
277 0.08
278 0.08
279 0.07
280 0.07
281 0.06
282 0.05
283 0.05
284 0.06
285 0.06
286 0.09
287 0.11
288 0.14
289 0.16
290 0.23
291 0.33
292 0.35
293 0.41
294 0.48
295 0.57
296 0.65
297 0.74
298 0.78
299 0.79
300 0.85
301 0.87
302 0.88
303 0.87
304 0.84
305 0.8
306 0.73
307 0.68
308 0.61
309 0.55