Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QVA2

Protein Details
Accession A0A5B1QVA2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-98SDRLPDRRLRGRRARSEAHKNPKAKBasic
NLS Segment(s)
PositionSequence
80-98RRLRGRRARSEAHKNPKAK
Subcellular Location(s) mito 17, nucl 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MVNRSTFLPELTSLLLPLCQATRCARRSVILEKSETFLHIVLKHATARFFPARCSIKNKAVVKVLRVCPCFLQSDRLPDRRLRGRRARSEAHKNPKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.1
6 0.08
7 0.11
8 0.17
9 0.25
10 0.27
11 0.3
12 0.3
13 0.32
14 0.36
15 0.4
16 0.41
17 0.36
18 0.37
19 0.34
20 0.35
21 0.32
22 0.28
23 0.22
24 0.14
25 0.14
26 0.12
27 0.13
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.12
34 0.16
35 0.18
36 0.17
37 0.17
38 0.23
39 0.26
40 0.27
41 0.34
42 0.35
43 0.37
44 0.46
45 0.47
46 0.43
47 0.47
48 0.46
49 0.44
50 0.47
51 0.47
52 0.45
53 0.44
54 0.41
55 0.35
56 0.36
57 0.36
58 0.29
59 0.29
60 0.25
61 0.34
62 0.4
63 0.43
64 0.44
65 0.43
66 0.51
67 0.54
68 0.59
69 0.59
70 0.63
71 0.68
72 0.76
73 0.8
74 0.81
75 0.8
76 0.84
77 0.85
78 0.85