Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RBT7

Protein Details
Accession A0A5B1RBT7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
435-466SLVVTRRPPRHLHHRRHCPRRLAPHQRRYALQBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTPTPPSFVPLASPRRRMVPAQHGLASQHRNVFVCTRLDSIVARRPHHMHCRHPMRLIVASHALSLPRMAPSVLAPHHTHHRLSALTIAALRAYQHAPSPWRTPCTPGASYCPARAVVARTPYRLLVSGVASIGGAVSCTSRHPLPHPLPSLARSHIFAIRCQLSTFRLSRMPSTVSCPQAYPARSRARTAPTLPFRVRAPPLNWPRSSLPCCSSATSRPDGVSRPSAAVLRCPLAQTAPFAQPPPRPLRALPCRSLHTPPHLLRAPPSVHCDALSSRHAAPSCTVSPRPELSRARLAYRVPRALFVPSHTIAPPSQHHRTALSTPSLLRHMPSLLRPALPSLLGPTAPSLAHPCDALTHSRALRRRHFVAGDPAPPSHALALSPHMHVLPSHAPMALSRSSASACVALSALTWRLTPSPSPSPAISRTVTRTLSLVVTRRPPRHLHHRRHCPRRLAPHQRRYALQRDHIARQLRGLALVTAPRAPATLPNVAITYPRAVPVARPRAAASPSAAVVAAPSTPSLPAPSPPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.57
4 0.56
5 0.56
6 0.56
7 0.56
8 0.56
9 0.56
10 0.51
11 0.51
12 0.54
13 0.49
14 0.43
15 0.39
16 0.37
17 0.35
18 0.36
19 0.37
20 0.33
21 0.32
22 0.3
23 0.28
24 0.26
25 0.27
26 0.26
27 0.29
28 0.33
29 0.36
30 0.35
31 0.39
32 0.43
33 0.5
34 0.58
35 0.59
36 0.61
37 0.65
38 0.73
39 0.72
40 0.72
41 0.67
42 0.61
43 0.59
44 0.51
45 0.45
46 0.4
47 0.35
48 0.32
49 0.29
50 0.25
51 0.18
52 0.18
53 0.15
54 0.11
55 0.12
56 0.11
57 0.1
58 0.11
59 0.18
60 0.18
61 0.22
62 0.22
63 0.25
64 0.34
65 0.37
66 0.36
67 0.31
68 0.33
69 0.29
70 0.29
71 0.29
72 0.21
73 0.19
74 0.19
75 0.17
76 0.13
77 0.13
78 0.12
79 0.11
80 0.11
81 0.11
82 0.13
83 0.17
84 0.21
85 0.26
86 0.32
87 0.34
88 0.38
89 0.38
90 0.4
91 0.43
92 0.46
93 0.44
94 0.4
95 0.42
96 0.45
97 0.46
98 0.42
99 0.37
100 0.31
101 0.29
102 0.28
103 0.26
104 0.23
105 0.3
106 0.31
107 0.31
108 0.32
109 0.32
110 0.32
111 0.28
112 0.24
113 0.18
114 0.16
115 0.15
116 0.14
117 0.13
118 0.11
119 0.09
120 0.08
121 0.05
122 0.04
123 0.03
124 0.04
125 0.04
126 0.06
127 0.09
128 0.1
129 0.12
130 0.16
131 0.26
132 0.3
133 0.38
134 0.41
135 0.41
136 0.42
137 0.42
138 0.43
139 0.35
140 0.32
141 0.25
142 0.24
143 0.25
144 0.24
145 0.22
146 0.25
147 0.25
148 0.24
149 0.23
150 0.22
151 0.2
152 0.25
153 0.25
154 0.22
155 0.24
156 0.24
157 0.26
158 0.27
159 0.28
160 0.23
161 0.28
162 0.31
163 0.3
164 0.29
165 0.28
166 0.27
167 0.3
168 0.31
169 0.29
170 0.31
171 0.37
172 0.38
173 0.39
174 0.43
175 0.43
176 0.45
177 0.45
178 0.46
179 0.43
180 0.49
181 0.47
182 0.44
183 0.39
184 0.4
185 0.39
186 0.36
187 0.32
188 0.35
189 0.44
190 0.49
191 0.48
192 0.46
193 0.47
194 0.49
195 0.49
196 0.43
197 0.36
198 0.32
199 0.33
200 0.31
201 0.3
202 0.28
203 0.3
204 0.29
205 0.28
206 0.26
207 0.26
208 0.26
209 0.26
210 0.23
211 0.19
212 0.18
213 0.17
214 0.19
215 0.18
216 0.18
217 0.16
218 0.15
219 0.14
220 0.14
221 0.13
222 0.11
223 0.12
224 0.12
225 0.13
226 0.14
227 0.15
228 0.15
229 0.19
230 0.2
231 0.24
232 0.28
233 0.28
234 0.26
235 0.27
236 0.35
237 0.42
238 0.45
239 0.45
240 0.42
241 0.43
242 0.44
243 0.48
244 0.41
245 0.37
246 0.39
247 0.35
248 0.39
249 0.37
250 0.34
251 0.31
252 0.34
253 0.3
254 0.24
255 0.28
256 0.22
257 0.21
258 0.21
259 0.21
260 0.16
261 0.18
262 0.17
263 0.15
264 0.14
265 0.17
266 0.17
267 0.16
268 0.16
269 0.17
270 0.17
271 0.18
272 0.19
273 0.18
274 0.2
275 0.23
276 0.24
277 0.27
278 0.28
279 0.29
280 0.35
281 0.35
282 0.35
283 0.36
284 0.35
285 0.35
286 0.38
287 0.39
288 0.31
289 0.31
290 0.29
291 0.28
292 0.27
293 0.22
294 0.22
295 0.17
296 0.19
297 0.18
298 0.18
299 0.16
300 0.19
301 0.2
302 0.22
303 0.26
304 0.26
305 0.27
306 0.27
307 0.3
308 0.29
309 0.29
310 0.24
311 0.21
312 0.2
313 0.21
314 0.21
315 0.19
316 0.16
317 0.14
318 0.13
319 0.14
320 0.15
321 0.19
322 0.18
323 0.18
324 0.18
325 0.18
326 0.17
327 0.16
328 0.14
329 0.11
330 0.11
331 0.1
332 0.1
333 0.09
334 0.1
335 0.09
336 0.1
337 0.1
338 0.11
339 0.11
340 0.11
341 0.11
342 0.11
343 0.13
344 0.15
345 0.14
346 0.17
347 0.19
348 0.25
349 0.31
350 0.36
351 0.42
352 0.46
353 0.48
354 0.49
355 0.48
356 0.46
357 0.49
358 0.47
359 0.43
360 0.38
361 0.34
362 0.3
363 0.28
364 0.25
365 0.17
366 0.13
367 0.09
368 0.09
369 0.13
370 0.14
371 0.14
372 0.14
373 0.14
374 0.13
375 0.13
376 0.17
377 0.15
378 0.16
379 0.16
380 0.16
381 0.16
382 0.16
383 0.2
384 0.16
385 0.14
386 0.12
387 0.12
388 0.13
389 0.13
390 0.14
391 0.11
392 0.09
393 0.09
394 0.08
395 0.07
396 0.07
397 0.08
398 0.09
399 0.09
400 0.09
401 0.1
402 0.11
403 0.13
404 0.15
405 0.19
406 0.25
407 0.27
408 0.3
409 0.3
410 0.34
411 0.35
412 0.38
413 0.33
414 0.3
415 0.32
416 0.35
417 0.35
418 0.3
419 0.28
420 0.25
421 0.27
422 0.27
423 0.26
424 0.25
425 0.33
426 0.41
427 0.44
428 0.47
429 0.5
430 0.54
431 0.62
432 0.68
433 0.7
434 0.73
435 0.8
436 0.86
437 0.91
438 0.91
439 0.9
440 0.88
441 0.88
442 0.89
443 0.89
444 0.89
445 0.89
446 0.89
447 0.83
448 0.79
449 0.75
450 0.74
451 0.7
452 0.66
453 0.65
454 0.61
455 0.62
456 0.64
457 0.63
458 0.54
459 0.49
460 0.46
461 0.38
462 0.33
463 0.29
464 0.23
465 0.19
466 0.21
467 0.19
468 0.16
469 0.16
470 0.14
471 0.14
472 0.13
473 0.16
474 0.19
475 0.22
476 0.22
477 0.23
478 0.24
479 0.24
480 0.25
481 0.22
482 0.21
483 0.17
484 0.17
485 0.17
486 0.17
487 0.23
488 0.32
489 0.4
490 0.38
491 0.39
492 0.4
493 0.45
494 0.46
495 0.42
496 0.35
497 0.28
498 0.26
499 0.25
500 0.23
501 0.17
502 0.15
503 0.13
504 0.1
505 0.08
506 0.08
507 0.08
508 0.09
509 0.1
510 0.14
511 0.14
512 0.18