Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R265

Protein Details
Accession A0A5B1R265    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLAPRPPRPRRRTRSHSPTRTQSRTPHydrophilic
NLS Segment(s)
PositionSequence
5-14RPPRPRRRTR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MLAPRPPRPRRRTRSHSPTRTQSRTPPALPPFLPSSDPPFVSLRHARPWVAVPADPSPPPALELVSRRDPASDPAILSSLGHTVPTTPSLALSPRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.9
4 0.87
5 0.88
6 0.87
7 0.84
8 0.77
9 0.74
10 0.72
11 0.68
12 0.61
13 0.59
14 0.52
15 0.51
16 0.46
17 0.42
18 0.36
19 0.31
20 0.31
21 0.24
22 0.27
23 0.24
24 0.24
25 0.23
26 0.22
27 0.21
28 0.24
29 0.28
30 0.24
31 0.27
32 0.28
33 0.26
34 0.26
35 0.27
36 0.24
37 0.2
38 0.18
39 0.15
40 0.16
41 0.18
42 0.17
43 0.16
44 0.14
45 0.13
46 0.13
47 0.11
48 0.1
49 0.11
50 0.14
51 0.18
52 0.22
53 0.23
54 0.22
55 0.23
56 0.23
57 0.24
58 0.25
59 0.21
60 0.17
61 0.17
62 0.18
63 0.17
64 0.16
65 0.13
66 0.11
67 0.09
68 0.09
69 0.08
70 0.08
71 0.1
72 0.12
73 0.12
74 0.11
75 0.12
76 0.13
77 0.16