Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QQ44

Protein Details
Accession A0A5B1QQ44    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LAAQRWREWSQRSRRRRRRHHHBasic
NLS Segment(s)
PositionSequence
67-78QRSRRRRRRHHH
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences METNSSTSAAANAPAQSTSSSQTSGATANSSVVDMITEMWAEQPPEAREEYRIREELAAQRWREWSQRSRRRRRRHHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.14
6 0.14
7 0.14
8 0.14
9 0.14
10 0.14
11 0.14
12 0.12
13 0.11
14 0.09
15 0.09
16 0.09
17 0.08
18 0.07
19 0.06
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.04
27 0.05
28 0.05
29 0.05
30 0.08
31 0.08
32 0.1
33 0.12
34 0.12
35 0.16
36 0.19
37 0.24
38 0.25
39 0.26
40 0.25
41 0.25
42 0.28
43 0.3
44 0.34
45 0.36
46 0.32
47 0.33
48 0.36
49 0.38
50 0.41
51 0.41
52 0.43
53 0.48
54 0.58
55 0.67
56 0.75
57 0.83
58 0.88